Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7904.t1
Gene name
Locationscaffold_27:107215..108896
Strand-
Gene length (bp)1681
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain 2.3E-49 13 230
PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain 2.8E-40 333 483

GO

GO Term Description Terminal node
GO:0006084 acetyl-CoA metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0051186 cofactor metabolic process No
GO:0009987 cellular process No
GO:0006793 phosphorus metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0009259 ribonucleotide metabolic process No
GO:0035383 thioester metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006732 coenzyme metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0006163 purine nucleotide metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0019693 ribose phosphate metabolic process No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0008152 metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0006637 acyl-CoA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7904.t1
MSASALLKSRVRRPSYLKKLAKAEDLIHHFPNGTYIGWSGFTGVGYPKMIPNALADHVQTNSLEGKLKYNLFVGA
SAGADTESRWAHLNMIERRSPHQVGKEIAKGINTGHIKFFDKHLSMFPSDLVYGWYTLNKPKPTIDVAIIEATAI
TEDGGIIPGASVGASPELIQMAEKVIIEVNTAMPSFEGLHDITGTDLPPFRKPYLVTRPDDRIGTTYIPVDPEKV
VAIVESDYADKTTHNSPEDEGSQAIASNLIEFLQHEVKHGRLPTNLLPIQSGIGNIANAVVGGLSKGGADFKNLT
VWTEVLQDAFLDLFDSGNLDFATATSIRLSPDGFKRFYANWDRYAPKILLRSQQVSNSPEIIRRLGCIGMNTPVE
VDIYAHANSTCVMGSRMLNGLGGSADFLRNSKYSIMHTPSARPTKTDPTGVSCIVPFATHIDQTEHDLDVIVTEQ
GLADVRGLSPRERARVIIKHCSHPDYTPILTDYLDRAEFECLRKGMGHEPHMLFQAFNMHKNLQEKGTMKIDSWE
*
Coding >Pro_DTO377G3_2|g7904.t1
ATGTCTGCTTCGGCCTTGTTGAAGAGCCGTGTACGGCGCCCATCGTATCTGAAGAAGCTCGCCAAAGCCGAGGAT
CTGATTCACCACTTCCCCAATGGCACGTACATTGGTTGGTCCGGATTCACCGGTGTCGGTTATCCCAAGATGATC
CCCAATGCGCTGGCCGATCACGTCCAGACGAACAGCCTCGAGGGAAAGCTGAAGTACAACCTGTTTGTCGGTGCC
TCCGCCGGCGCAGACACCGAGAGCCGTTGGGCGCACTTGAACATGATTGAGCGCCGCAGCCCTCACCAGGTTGGA
AAGGAAATCGCCAAGGGAATCAACACCGGCCACATCAAGTTCTTCGATAAGCATCTGAGCATGTTCCCTTCGGAT
TTGGTCTATGGTTGGTACACTTTGAACAAGCCCAAGCCCACTATCGACGTGGCTATCATTGAGGCTACTGCCATC
ACCGAGGACGGTGGCATCATCCCCGGTGCTTCCGTCGGTGCTTCTCCCGAGCTGATCCAGATGGCCGAGAAGGTC
ATCATCGAGGTCAACACCGCCATGCCCTCCTTCGAGGGTCTGCACGATATCACCGGCACCGACCTCCCCCCCTTC
CGCAAGCCCTACCTCGTCACCCGTCCCGACGACCGCATCGGAACAACCTACATCCCCGTCGACCCGGAGAAGGTT
GTGGCCATCGTCGAGTCCGACTATGCCGACAAGACCACGCACAACTCCCCCGAAGACGAAGGCTCGCAAGCCATC
GCCTCGAACCTGATCGAGTTCCTCCAGCATGAGGTCAAGCACGGCCGTCTCCCAACCAACCTGCTCCCCATCCAG
TCCGGCATCGGCAACATCGCCAACGCCGTCGTAGGCGGTCTCAGCAAGGGCGGCGCTGACTTCAAGAACCTAACC
GTGTGGACCGAAGTCCTGCAAGATGCCTTCCTCGACCTCTTCGATAGCGGCAACCTCGACTTCGCCACCGCGACC
TCCATCCGCCTGTCCCCCGACGGCTTCAAGCGCTTCTACGCCAACTGGGACCGCTACGCGCCCAAGATCCTCCTG
CGCTCGCAGCAAGTCTCCAACTCCCCCGAGATCATCCGTCGTCTCGGCTGCATCGGCATGAACACGCCCGTCGAA
GTCGACATCTACGCGCACGCCAACAGCACCTGCGTGATGGGCTCGCGCATGCTCAACGGCCTCGGCGGCTCCGCC
GATTTCCTGCGCAACTCCAAGTACAGTATCATGCACACCCCGTCCGCGCGTCCCACCAAGACCGATCCCACCGGT
GTCAGCTGTATCGTTCCGTTCGCCACGCACATCGACCAGACCGAGCACGATCTTGACGTTATCGTGACCGAGCAG
GGTCTTGCTGATGTTCGTGGTTTGTCTCCTCGTGAGCGTGCCCGTGTTATCATCAAGCACTGCTCGCACCCTGAC
TACACTCCTATCCTGACGGATTACCTTGACCGTGCGGAGTTCGAGTGTCTGCGTAAGGGTATGGGTCATGAGCCT
CATATGCTCTTCCAGGCTTTCAACATGCACAAGAATCTGCAGGAGAAGGGTACCATGAAGATTGACTCTTGGGAG
TAG
Transcript >Pro_DTO377G3_2|g7904.t1
ATGTCTGCTTCGGCCTTGTTGAAGAGCCGTGTACGGCGCCCATCGTATCTGAAGAAGCTCGCCAAAGCCGAGGAT
CTGATTCACCACTTCCCCAATGGCACGTACATTGGTTGGTCCGGATTCACCGGTGTCGGTTATCCCAAGATGATC
CCCAATGCGCTGGCCGATCACGTCCAGACGAACAGCCTCGAGGGAAAGCTGAAGTACAACCTGTTTGTCGGTGCC
TCCGCCGGCGCAGACACCGAGAGCCGTTGGGCGCACTTGAACATGATTGAGCGCCGCAGCCCTCACCAGGTTGGA
AAGGAAATCGCCAAGGGAATCAACACCGGCCACATCAAGTTCTTCGATAAGCATCTGAGCATGTTCCCTTCGGAT
TTGGTCTATGGTTGGTACACTTTGAACAAGCCCAAGCCCACTATCGACGTGGCTATCATTGAGGCTACTGCCATC
ACCGAGGACGGTGGCATCATCCCCGGTGCTTCCGTCGGTGCTTCTCCCGAGCTGATCCAGATGGCCGAGAAGGTC
ATCATCGAGGTCAACACCGCCATGCCCTCCTTCGAGGGTCTGCACGATATCACCGGCACCGACCTCCCCCCCTTC
CGCAAGCCCTACCTCGTCACCCGTCCCGACGACCGCATCGGAACAACCTACATCCCCGTCGACCCGGAGAAGGTT
GTGGCCATCGTCGAGTCCGACTATGCCGACAAGACCACGCACAACTCCCCCGAAGACGAAGGCTCGCAAGCCATC
GCCTCGAACCTGATCGAGTTCCTCCAGCATGAGGTCAAGCACGGCCGTCTCCCAACCAACCTGCTCCCCATCCAG
TCCGGCATCGGCAACATCGCCAACGCCGTCGTAGGCGGTCTCAGCAAGGGCGGCGCTGACTTCAAGAACCTAACC
GTGTGGACCGAAGTCCTGCAAGATGCCTTCCTCGACCTCTTCGATAGCGGCAACCTCGACTTCGCCACCGCGACC
TCCATCCGCCTGTCCCCCGACGGCTTCAAGCGCTTCTACGCCAACTGGGACCGCTACGCGCCCAAGATCCTCCTG
CGCTCGCAGCAAGTCTCCAACTCCCCCGAGATCATCCGTCGTCTCGGCTGCATCGGCATGAACACGCCCGTCGAA
GTCGACATCTACGCGCACGCCAACAGCACCTGCGTGATGGGCTCGCGCATGCTCAACGGCCTCGGCGGCTCCGCC
GATTTCCTGCGCAACTCCAAGTACAGTATCATGCACACCCCGTCCGCGCGTCCCACCAAGACCGATCCCACCGGT
GTCAGCTGTATCGTTCCGTTCGCCACGCACATCGACCAGACCGAGCACGATCTTGACGTTATCGTGACCGAGCAG
GGTCTTGCTGATGTTCGTGGTTTGTCTCCTCGTGAGCGTGCCCGTGTTATCATCAAGCACTGCTCGCACCCTGAC
TACACTCCTATCCTGACGGATTACCTTGACCGTGCGGAGTTCGAGTGTCTGCGTAAGGGTATGGGTCATGAGCCT
CATATGCTCTTCCAGGCTTTCAACATGCACAAGAATCTGCAGGAGAAGGGTACCATGAAGATTGACTCTTGGGAG
TAG
Gene >Pro_DTO377G3_2|g7904.t1
ATGTCTGCTTCGGCCTTGTTGAAGAGCCGTGTACGGCGCCCATCGTATCTGAAGAAGCTCGCCAAAGCCGAGGAT
CTGATTCACCACTTCCCCAATGGCACGTACATTGGTTGGTCCGGATTCACCGGTGTCGGTTATCCCAAGTATGTA
CCGCGACGATACTATAGTAAGCGAGGGCAACGCTAACCCGATCCAGGATGATCCCCAATGCGCTGGCCGATCACG
TCCAGACGAACAGCCTCGAGGGAAAGCTGAAGTACAACCTGTTTGTCGGTGCCTCCGCCGGCGCAGACACCGAGA
GCCGTTGGGCGCACTTGAACATGATTGAGCGCCGCAGCCCTCACCAGGTTGGAAAGGAAATCGCCAAGGGAATCA
ACACCGGCCACATCAAGTTCTTCGATAAGCATCTGAGCATGTTCCCTTCGGATTTGGTCTATGTGAGTTTTGCGT
TACCGGAGAAAAATATTCACCGCTAACAATTTCCCAGGGTTGGTACACTTTGAACAAGCCCAAGCCCACTATCGA
CGTGGCTATCATTGAGGCTACTGCCATCACCGAGGACGGTGGCATCATCCCCGGTGCTTCCGTCGGTGCTTCTCC
CGAGCTGATCCAGATGGCCGAGAAGGTCATCATCGAGGTCAACACCGCCATGCCCTCCTTCGAGGGTCTGCACGA
TATCACCGGCACCGACCTCCCCCCCTTCCGCAAGCCCTACCTCGTCACCCGTCCCGACGACCGCATCGGAACAAC
CTACATCCCCGTCGACCCGGAGAAGGTTGTGGCCATCGTCGAGTCCGACTATGCCGACAAGACCACGCACAACTC
CCCCGAAGACGAAGGCTCGCAAGCCATCGCCTCGAACCTGATCGAGTTCCTCCAGCATGAGGTCAAGCACGGCCG
TCTCCCAACCAACCTGCTCCCCATCCAGTCCGGCATCGGCAACATCGCCAACGCCGTCGTAGGCGGTCTCAGCAA
GGGCGGCGCTGACTTCAAGAACCTAACCGTGTGGACCGAAGTCCTGCAAGATGCCTTCCTCGACCTCTTCGATAG
CGGCAACCTCGACTTCGCCACCGCGACCTCCATCCGCCTGTCCCCCGACGGCTTCAAGCGCTTCTACGCCAACTG
GGACCGCTACGCGCCCAAGATCCTCCTGCGCTCGCAGCAAGTCTCCAACTCCCCCGAGATCATCCGTCGTCTCGG
CTGCATCGGCATGAACACGCCCGTCGAAGTCGACATCTACGCGCACGCCAACAGCACCTGCGTGATGGGCTCGCG
CATGCTCAACGGCCTCGGCGGCTCCGCCGATTTCCTGCGCAACTCCAAGTACAGTATCATGCACACCCCGTCCGC
GCGTCCCACCAAGACCGATCCCACCGGTGTCAGCTGTATCGTTCCGTTCGCCACGCACATCGACCAGACCGAGCA
CGATCTTGACGTTATCGTGACCGAGCAGGGTCTTGCTGATGTTCGTGGTTTGTCTCCTCGTGAGCGTGCCCGTGT
TATCATCAAGCACTGCTCGCACCCTGACTACACTCCTATCCTGACGGATTACCTTGACCGTGCGGAGTTCGAGTG
TCTGCGTAAGGGTATGGGTCATGAGCCTCATATGCTCTTCCAGGCTTTCAACATGCACAAGAATCTGCAGGAGAA
GGGTACCATGAAGATTGACTCTTGGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail