Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g789.t1
Gene name
Locationscaffold_01:2110064..2111255
Strand-
Gene length (bp)1191
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00096 zf-C2H2 Zinc finger, C2H2 type 1.0E-02 247 268
PF00096 zf-C2H2 Zinc finger, C2H2 type 9.5E-06 276 299
PF13894 zf-C2H2_4 C2H2-type zinc finger 1.0E-03 276 299
PF13912 zf-C2H2_6 C2H2-type zinc finger 1.2E-02 276 299
PF13912 zf-C2H2_6 C2H2-type zinc finger 7.7E-03 305 323

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
C2H2 zinc finger

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.33 0.73 5.93
5d_25C Five days - 25 degrees Celsius 2.70 0.47 4.92
7d_25C Seven days - 25 degrees Celsius 2.55 0.35 4.75
10d_25C Ten days - 25 degrees Celsius 2.26 0.23 4.29
7d_15C Seven days - 15 degrees Celsius 4.52 1.22 7.81
7d_30C Seven days - 30 degrees Celsius 3.95 0.94 6.97

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.733869 no
3d_25C 7d_25C 0.658915 no
3d_25C 7d_15C 0.559488 no
3d_25C 7d_30C 0.775124 no
3d_25C 10d_25C 0.504405 no
5d_25C 7d_25C 0.942001 no
5d_25C 7d_15C 0.291041 no
5d_25C 7d_30C 0.474687 no
5d_25C 10d_25C 0.800409 no
7d_25C 7d_15C 0.232556 no
7d_25C 7d_30C 0.408515 no
7d_25C 10d_25C 0.874490 no
7d_15C 7d_30C 0.820842 no
7d_15C 10d_25C 0.159755 no
7d_30C 10d_25C 0.281796 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g789.t1
MNRNLVQRTSITSPRREEIQSCEASSIYSSPVSTSSQGGVSPIGLGISRCDIDNGFGQLRAFPTSTLPSQLIPGA
PNPTFALSYDDFAGACYPSVYDGLVNSASETSLGFYSPTTMSASPSYNSGMEIASGQNVFAGQMTDMWMHTPCSG
PTTPSDVVTVPNGAGQWDQSVYSDVCMPSPMPLLSVNDMSYLGAMGEEIGYDGSGINTGQVLQPQASIEGFSDGV
TDPSTIERCASNDRLVSASGLECPICGAKFTRRSNCKEHQKLHNPEWRHNHPCDECHKSFGRSSDLKRHMNTVHL
GLRKYCCDSCDRRFSRQDSLARHDCAEKQRNTAKFTGHVDPSLTPKQRQRVPNHRRSAS*
Coding >Pro_DTO377G3_2|g789.t1
ATGAATCGGAATTTAGTTCAGCGCACCTCAATTACATCCCCGCGAAGAGAGGAGATACAGTCTTGCGAAGCATCC
TCAATATACTCGTCTCCTGTTTCGACCTCGTCCCAGGGAGGTGTTTCCCCTATTGGTCTGGGAATTTCCCGCTGC
GACATCGACAATGGATTCGGTCAACTGAGGGCCTTCCCTACGTCGACACTGCCATCGCAACTGATTCCTGGAGCG
CCAAATCCCACCTTCGCATTATCCTATGACGACTTTGCCGGAGCATGCTATCCATCAGTTTACGATGGACTCGTC
AACAGTGCTTCAGAGACTTCACTGGGGTTCTACAGCCCCACGACGATGAGCGCGTCTCCCAGCTACAACTCTGGC
ATGGAGATTGCCTCTGGCCAGAATGTCTTCGCGGGCCAAATGACCGATATGTGGATGCACACACCTTGCTCGGGA
CCGACAACGCCATCGGATGTGGTCACTGTACCGAACGGCGCAGGACAATGGGACCAGAGTGTGTATTCGGACGTG
TGTATGCCCTCTCCGATGCCCCTATTATCCGTCAACGACATGTCCTACCTTGGGGCGATGGGAGAGGAGATTGGA
TACGATGGATCTGGAATCAACACTGGTCAAGTCTTGCAACCCCAAGCATCTATCGAAGGATTCTCCGATGGTGTC
ACGGACCCGAGTACAATAGAGCGCTGCGCGTCAAATGACAGGCTAGTATCTGCCAGTGGCCTGGAATGTCCAATT
TGTGGCGCAAAATTCACGCGACGCTCCAACTGCAAGGAGCACCAAAAGCTGCACAACCCTGAATGGAGGCACAAC
CATCCTTGCGATGAGTGCCACAAGTCTTTTGGCCGGAGCTCGGATCTCAAACGACACATGAACACCGTTCATCTC
GGGCTTCGGAAGTACTGCTGTGACTCTTGCGACCGGCGTTTCAGTCGTCAGGATAGTCTAGCCAGACATGATTGT
GCGGAGAAGCAGCGCAACACTGCGAAGTTTACCGGCCACGTTGATCCTTCGCTCACGCCCAAGCAACGCCAACGA
GTGCCGAATCACCGCCGCTCAGCTAGCTAG
Transcript >Pro_DTO377G3_2|g789.t1
ATGAATCGGAATTTAGTTCAGCGCACCTCAATTACATCCCCGCGAAGAGAGGAGATACAGTCTTGCGAAGCATCC
TCAATATACTCGTCTCCTGTTTCGACCTCGTCCCAGGGAGGTGTTTCCCCTATTGGTCTGGGAATTTCCCGCTGC
GACATCGACAATGGATTCGGTCAACTGAGGGCCTTCCCTACGTCGACACTGCCATCGCAACTGATTCCTGGAGCG
CCAAATCCCACCTTCGCATTATCCTATGACGACTTTGCCGGAGCATGCTATCCATCAGTTTACGATGGACTCGTC
AACAGTGCTTCAGAGACTTCACTGGGGTTCTACAGCCCCACGACGATGAGCGCGTCTCCCAGCTACAACTCTGGC
ATGGAGATTGCCTCTGGCCAGAATGTCTTCGCGGGCCAAATGACCGATATGTGGATGCACACACCTTGCTCGGGA
CCGACAACGCCATCGGATGTGGTCACTGTACCGAACGGCGCAGGACAATGGGACCAGAGTGTGTATTCGGACGTG
TGTATGCCCTCTCCGATGCCCCTATTATCCGTCAACGACATGTCCTACCTTGGGGCGATGGGAGAGGAGATTGGA
TACGATGGATCTGGAATCAACACTGGTCAAGTCTTGCAACCCCAAGCATCTATCGAAGGATTCTCCGATGGTGTC
ACGGACCCGAGTACAATAGAGCGCTGCGCGTCAAATGACAGGCTAGTATCTGCCAGTGGCCTGGAATGTCCAATT
TGTGGCGCAAAATTCACGCGACGCTCCAACTGCAAGGAGCACCAAAAGCTGCACAACCCTGAATGGAGGCACAAC
CATCCTTGCGATGAGTGCCACAAGTCTTTTGGCCGGAGCTCGGATCTCAAACGACACATGAACACCGTTCATCTC
GGGCTTCGGAAGTACTGCTGTGACTCTTGCGACCGGCGTTTCAGTCGTCAGGATAGTCTAGCCAGACATGATTGT
GCGGAGAAGCAGCGCAACACTGCGAAGTTTACCGGCCACGTTGATCCTTCGCTCACGCCCAAGCAACGCCAACGA
GTGCCGAATCACCGCCGCTCAGCTAGCTAG
Gene >Pro_DTO377G3_2|g789.t1
ATGAATCGGAATTTAGTTCAGCGCACCTCAATTACATCCCCGCGAAGAGAGGAGATACAGTCTTGCGAAGCATCC
TCAATATACTCGTCTCCTGTTTCGACCTCGTCCCAGGGAGGTGTTTCCCCTATTGGTCTGGGAATTTCCCGCTGC
GACATCGACAATGGATTCGGTCAACTGAGGGCCTTCCCTACGTCGACACTGCCATCGCAACTGATTCCTGGAGCG
CCAAATCCCACCTTCGCATTATCCTATGACGACTTTGCCGGAGCATGCTATCCATCAGTTTACGATGGACTCGTC
AACAGTGCTTCAGAGACTTCACTGGGGTTCTACAGCCCCACGACGATGAGCGCGTCTCCCAGCTACAACTCTGGC
ATGGAGATTGCCTCTGGCCAGAATGTCTTCGCGGGCCAAATGACCGATATGTGGATGCACACACCTTGCTCGGGA
CCGACAACGCCATCGGATGTGGTCACTGTACCGAACGGCGCAGGACAATGGGACCAGAGTGTGTATTCGGACGTG
TGTATGCCCTCTCCGATGCCCCTATTATCCGTCAACGACATGTCCTACCTTGGGGCGATGGGAGAGGAGATTGGA
TACGATGGATCTGGAATCAACACTGGTCAAGTCTTGCAACCCCAAGCATCTATCGAAGGATTCTCCGATGGTGTC
ACGGACCCGAGTACAATAGAGCGCTGCGCGTCAAATGACAGGCTAGTATCTGCCAGTGGCCTGGAATGTCCAATT
TGTGGCGCAAAATTCACGCGACGCTCCAACTGCAAGGAGCACCAAAAGCTGCACAACCCTGAATGGAGGCACAAC
CATCCTTGCGATGAGTGCCACAAGTCTTTTGGCCGGAGCTCGGATCTCAAACGACACATGAACACCGTGAGTAGG
GAGGCCAGACGGAATCAAGCATAGACACTAACAAGGTCTCTAGGTTCATCTCGGGCTTCGGAAGTACTGCTGTGA
CTCTTGCGACCGGCGTTTCAGTCGTCAGGATAGTCTAGCCAGGTAAGAACCCAGAATATTTATCCTTGAATGTGT
ACTCGTGGGACTAATATGAGCAATAGACATGATTGTGCGGAGAAGCAGCGCAACACTGCGAAGTTTACCGGCCAC
GTTGATCCTTCGCTCACGCCCAAGCAACGCCAACGAGTGCCGAATCACCGCCGCTCAGCTAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail