Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g787.t1
Gene name
Locationscaffold_01:2102933..2104618
Strand+
Gene length (bp)1685
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00743 FMO-like Flavin-binding monooxygenase-like 1.4E-21 88 256
PF00743 FMO-like Flavin-binding monooxygenase-like 9.9E-06 296 433
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 6.5E-16 6 355
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 2.5E-11 168 327
PF13454 NAD_binding_9 FAD-NAD(P)-binding 1.2E-07 8 184
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.5E-06 9 43

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0050661 NADP binding Yes
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0004497 monooxygenase activity No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.20 1.29 7.10
5d_25C Five days - 25 degrees Celsius 2.09 0.40 3.77
7d_25C Seven days - 25 degrees Celsius 1.45 0.06 2.85
10d_25C Ten days - 25 degrees Celsius 0.70 0.00 1.44
7d_15C Seven days - 15 degrees Celsius 0.91 0.00 2.02
7d_30C Seven days - 30 degrees Celsius 3.59 0.99 6.19

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.091757 no
3d_25C 7d_25C 0.040411 yes
3d_25C 7d_15C 0.019886 yes
3d_25C 7d_30C 0.770468 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.545522 no
5d_25C 7d_15C 0.196488 no
5d_25C 7d_30C 0.222175 no
5d_25C 10d_25C 0.043971 yes
7d_25C 7d_15C 0.529520 no
7d_25C 7d_30C 0.066809 no
7d_25C 10d_25C 0.222975 no
7d_15C 7d_30C 0.036939 yes
7d_15C 10d_25C 0.765596 no
7d_30C 10d_25C 0.002297 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g787.t1
MSESVRVAVIGAGISGVVTAGHLLAAGIQVTVFERNNATGGVWIYDKRTPIEAQYPSPRPSASQEYVKDEREGNE
RKVLLHAPPGPCYESLTNNVSTPLLRTKLNAWPEGTAPFVKHNVLKEYIQDTSKKAGVDDITKFGARVTRVHKDG
PKWTVHWSTLSEGQDPTEKEESATFDSVIVASGHYHTPLVPNIRGLPEAKAQWPERIFHSKSFRRSEGFKGKNVL
LLGGGVSSLDIATEISGTAHHVYQSTRNGAFDLPESALPENASRIAEVEAFEPSTSTSANTEHLPLTVHLKSGET
LHGIDTIILCTGYQMALPFLDEYNDYTSSAAEANDTVLVTDGTQVHNLHQDIFYIPDPTLAFVGIPFYTATFSLF
EFQAIAVTAFLSGVAQLPSTASLRTEYENRVKEKGLGRSFHSLKDKEQPYVEELIKWVNTGRAERGLPLIEGHTE
SWITERAALTERLKLILAGKLPRADILKSPLEVGVTA*
Coding >Pro_DTO377G3_2|g787.t1
ATGAGTGAGTCCGTTCGAGTTGCTGTTATTGGGGCTGGGATCAGTGGAGTGGTTACTGCTGGGCATCTTCTGGCA
GCTGGAATTCAGGTGACGGTGTTTGAGAGGAACAATGCAACTGGTGGAGTTTGGATTTATGATAAGCGTACTCCG
ATTGAAGCCCAGTACCCATCGCCAAGACCGTCTGCTTCACAGGAATATGTGAAGGATGAGAGGGAAGGGAATGAA
AGAAAGGTCTTGCTTCATGCGCCTCCGGGGCCTTGTTATGAAAGTCTCACCAATAATGTCTCGACACCCTTACTA
CGGACCAAACTCAACGCATGGCCAGAAGGAACTGCTCCTTTTGTGAAGCATAATGTGCTCAAGGAATACATCCAA
GACACGTCGAAGAAGGCCGGTGTTGATGATATAACCAAGTTTGGCGCCCGAGTGACCCGCGTCCATAAGGATGGA
CCAAAATGGACGGTTCACTGGAGCACTTTGAGCGAAGGCCAAGATCCCACCGAGAAGGAGGAGTCTGCAACGTTT
GACTCGGTGATTGTTGCCTCGGGCCATTACCATACGCCTCTCGTCCCGAATATACGGGGTCTACCAGAGGCAAAA
GCCCAATGGCCGGAGAGGATCTTCCATTCAAAGTCTTTCCGAAGGTCGGAAGGATTCAAAGGAAAGAATGTACTT
TTGCTCGGTGGAGGTGTCTCTTCTCTCGACATAGCCACTGAAATCAGTGGAACCGCACATCACGTGTACCAAAGC
ACCCGAAATGGTGCCTTCGATCTCCCCGAGAGTGCACTTCCAGAAAACGCATCAAGAATCGCCGAGGTCGAAGCA
TTCGAACCTTCTACATCGACATCCGCGAACACCGAGCACTTGCCCTTAACCGTACATCTCAAATCCGGGGAGACC
TTGCACGGTATAGACACAATTATTCTTTGCACAGGATATCAAATGGCACTTCCATTCCTCGACGAATATAATGAT
TACACTTCGTCTGCGGCCGAGGCAAATGATACCGTGCTCGTCACAGATGGCACTCAAGTCCACAACTTGCATCAA
GACATCTTCTACATCCCAGATCCCACGCTGGCGTTTGTCGGCATTCCATTCTACACCGCGACCTTCTCTCTATTC
GAGTTCCAAGCTATCGCCGTGACAGCCTTCCTGTCTGGAGTTGCGCAGCTTCCATCTACTGCGAGTCTCCGGACG
GAATATGAGAATCGGGTTAAAGAGAAGGGACTTGGACGGAGCTTCCACTCACTCAAGGATAAAGAGCAACCGTAT
GTCGAGGAATTGATCAAATGGGTTAATACTGGAAGAGCTGAGCGTGGTTTGCCTTTGATTGAGGGTCATACTGAG
AGCTGGATTACAGAGAGAGCGGCTTTGACCGAGAGACTTAAGTTGATTCTGGCAGGAAAGCTTCCTAGGGCGGAT
ATTCTCAAAAGCCCATTGGAGGTGGGGGTTACTGCATGA
Transcript >Pro_DTO377G3_2|g787.t1
ATGAGTGAGTCCGTTCGAGTTGCTGTTATTGGGGCTGGGATCAGTGGAGTGGTTACTGCTGGGCATCTTCTGGCA
GCTGGAATTCAGGTGACGGTGTTTGAGAGGAACAATGCAACTGGTGGAGTTTGGATTTATGATAAGCGTACTCCG
ATTGAAGCCCAGTACCCATCGCCAAGACCGTCTGCTTCACAGGAATATGTGAAGGATGAGAGGGAAGGGAATGAA
AGAAAGGTCTTGCTTCATGCGCCTCCGGGGCCTTGTTATGAAAGTCTCACCAATAATGTCTCGACACCCTTACTA
CGGACCAAACTCAACGCATGGCCAGAAGGAACTGCTCCTTTTGTGAAGCATAATGTGCTCAAGGAATACATCCAA
GACACGTCGAAGAAGGCCGGTGTTGATGATATAACCAAGTTTGGCGCCCGAGTGACCCGCGTCCATAAGGATGGA
CCAAAATGGACGGTTCACTGGAGCACTTTGAGCGAAGGCCAAGATCCCACCGAGAAGGAGGAGTCTGCAACGTTT
GACTCGGTGATTGTTGCCTCGGGCCATTACCATACGCCTCTCGTCCCGAATATACGGGGTCTACCAGAGGCAAAA
GCCCAATGGCCGGAGAGGATCTTCCATTCAAAGTCTTTCCGAAGGTCGGAAGGATTCAAAGGAAAGAATGTACTT
TTGCTCGGTGGAGGTGTCTCTTCTCTCGACATAGCCACTGAAATCAGTGGAACCGCACATCACGTGTACCAAAGC
ACCCGAAATGGTGCCTTCGATCTCCCCGAGAGTGCACTTCCAGAAAACGCATCAAGAATCGCCGAGGTCGAAGCA
TTCGAACCTTCTACATCGACATCCGCGAACACCGAGCACTTGCCCTTAACCGTACATCTCAAATCCGGGGAGACC
TTGCACGGTATAGACACAATTATTCTTTGCACAGGATATCAAATGGCACTTCCATTCCTCGACGAATATAATGAT
TACACTTCGTCTGCGGCCGAGGCAAATGATACCGTGCTCGTCACAGATGGCACTCAAGTCCACAACTTGCATCAA
GACATCTTCTACATCCCAGATCCCACGCTGGCGTTTGTCGGCATTCCATTCTACACCGCGACCTTCTCTCTATTC
GAGTTCCAAGCTATCGCCGTGACAGCCTTCCTGTCTGGAGTTGCGCAGCTTCCATCTACTGCGAGTCTCCGGACG
GAATATGAGAATCGGGTTAAAGAGAAGGGACTTGGACGGAGCTTCCACTCACTCAAGGATAAAGAGCAACCGTAT
GTCGAGGAATTGATCAAATGGGTTAATACTGGAAGAGCTGAGCGTGGTTTGCCTTTGATTGAGGGTCATACTGAG
AGCTGGATTACAGAGAGAGCGGCTTTGACCGAGAGACTTAAGTTGATTCTGGCAGGAAAGCTTCCTAGGGCGGAT
ATTCTCAAAAGCCCATTGGAGGTGGGGGTTACTGCATGA
Gene >Pro_DTO377G3_2|g787.t1
ATGAGTGAGTCCGTTCGAGTTGCTGTTATTGGGGCTGGGATCAGTGGAGTGGTTACTGCTGGGCATCTTCTGGCA
GCTGGAATTCAGGTGACGGTGTTTGAGAGGAACAATGCAACTGGTGGAGTTTGGTAAGATGGTGAATTGTTTATT
TTGATCTGGAATAATGGACTAAAGCATTGTAGGATTTATGATAAGCGTACTCCGATTGAAGCCCAGTACCCATCG
CCAAGACCGTCTGCTTCACAGGAATATGTGAAGGATGAGAGGGAAGGGAATGAAAGAAAGGTCTTGCTTCATGCG
CCTCCGGGGTAGGTTTCTGATTTATGTTTTTTTTTAACTATAGCAGGCGTACTCACTATTGACCAGGCCTTGTTA
TGAAAGTCTCACCAATAATGTCTCGACACCCTTACTACGGACCAAACTCAACGCATGGCCAGAAGGAACTGCTCC
TTTTGTGAAGCATAATGTGCTCAAGGAATACATCCAAGACACGTCGAAGAAGGCCGGTGTTGATGATATAACCAA
GTTTGGCGCCCGAGTGACCCGCGTCCATAAGGATGGACCAAAATGGACGGTTCACTGGAGCACTTTGAGCGAAGG
CCAAGATCCCACCGAGAAGGAGGAGTCTGCAGTAAGTTCTCATATCTATAAAATTTTTCATTCTCAGTGGTTCTG
ACCGGATCATAGACGTTTGACTCGGTGATTGTTGCCTCGGGCCATTACCATACGCCTCTCGTCCCGAATATACGG
GGTCTACCAGAGGCAAAAGCCCAATGGCCGGAGAGGATCTTCCATTCAAAGTCTTTCCGAAGGTCGGAAGGATTC
AAAGGAAAGGTAGGAGCGACTGCATTCTAGTATTGAGTGGCACTGAACTGACTCAACTACAGAATGTACTTTTGC
TCGGTGGAGGTGTCTCTTCTCTCGACATAGCCACTGAAATCAGTGGAACCGCACATCACGTGTACCAAAGCACCC
GAAATGGTGCCTTCGATCTCCCCGAGAGTGCACTTCCAGAAAACGCATCAAGAATCGCCGAGGTCGAAGCATTCG
AACCTTCTACATCGACATCCGCGAACACCGAGCACTTGCCCTTAACCGTACATCTCAAATCCGGGGAGACCTTGC
ACGGTATAGACACAATTATTCTTTGCACAGGATATCAAATGGCACTTCCATTCCTCGACGAATATAATGATTACA
CTTCGTCTGCGGCCGAGGCAAATGATACCGTGCTCGTCACAGATGGCACTCAAGTCCACAACTTGCATCAAGACA
TCTTCTACATCCCAGATCCCACGCTGGCGTTTGTCGGCATTCCATTCTACACCGCGACCTTCTCTCTATTCGAGT
TCCAAGCTATCGCCGTGACAGCCTTCCTGTCTGGAGTTGCGCAGCTTCCATCTACTGCGAGTCTCCGGACGGAAT
ATGAGAATCGGGTTAAAGAGAAGGGACTTGGACGGAGCTTCCACTCACTCAAGGATAAAGAGCAACCGTATGTCG
AGGAATTGATCAAATGGGTTAATACTGGAAGAGCTGAGCGTGGTTTGCCTTTGATTGAGGGTCATACTGAGAGCT
GGATTACAGAGAGAGCGGCTTTGACCGAGAGACTTAAGTTGATTCTGGCAGGAAAGCTTCCTAGGGCGGATATTC
TCAAAAGCCCATTGGAGGTGGGGGTTACTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail