Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7867.t1
Gene name
Locationscaffold_27:17121..19061
Strand+
Gene length (bp)1940
Transcript length (bp)1839
Coding sequence length (bp)1839
Protein length (aa) 613

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04137 ERO1 Endoplasmic Reticulum Oxidoreductin 1 (ERO1) 2.6E-136 58 456

GO

GO Term Description Terminal node
GO:0034975 protein folding in endoplasmic reticulum Yes
GO:0071949 FAD binding Yes
GO:0016972 thiol oxidase activity Yes
GO:0015035 protein-disulfide reductase activity Yes
GO:0005783 endoplasmic reticulum Yes
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0036094 small molecule binding No
GO:0043227 membrane-bounded organelle No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0043229 intracellular organelle No
GO:1901265 nucleoside phosphate binding No
GO:0015036 disulfide oxidoreductase activity No
GO:0043231 intracellular membrane-bounded organelle No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:0110165 cellular anatomical entity No
GO:0006457 protein folding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0043226 organelle No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7867.t1
MRSAARLLYAAVFALASLSHAAVHNPALDPTKCAIEPSAMVSDACVTYGEINGMNDLIFTTLNSLTQETDFFSYY
RLNLFNRQCPFWNDANSMCGNIACAVNTIDSEEDIPLTWRAEELSKLEGPKANHPPRNIQAERPKERPLQGELGE
DVGESCVVEYDDECEERDYCVPEDEGSAGKGDYVSLVDNPERFTGYSGEGANQVWDAIYRENCFLKPVAEELEEQ
SVNVPIGGLQAASDFRDVLQKESQRVESLSLDNECLEKRVFHRLLSGMHASISTHLCWDYLNQTTGLWHPNVQCF
KDRLLDHPERISNMYFNYALVSRAVAKLRKHLDGYTYCASDPVQDRETKKRVNKLTATLTELPQIFDEKIMFQDA
NAIGLKEDFRNRFRNVSRLMDCVGCDKCRLWGKLQVNGYGTALKVLFEYDETKNGENPPLRRTELVALINTLGRI
SHSIAASRSMQRALLTGTTHMFPVHGAVPSSHHANALGDNRRVFSDGNNNFYFEGEDNEDDYVYGRGAAPERYPW
ERKPPGPDDGWVEDFMSEWNMIWGTVGYIWQSWLDIPFTIYQIGTSEFIRLYNYWLGLPVPPRMWKLKTPQPRAH
TQPAAYANRDEL*
Coding >Pro_DTO377G3_2|g7867.t1
ATGCGGTCTGCAGCGAGGCTGCTCTATGCAGCAGTGTTTGCGCTTGCTAGCTTGAGCCATGCCGCCGTTCATAAT
CCTGCATTGGACCCAACTAAGTGTGCTATCGAACCTTCGGCCATGGTATCCGATGCGTGTGTCACATACGGCGAG
ATCAACGGCATGAATGACCTGATTTTCACGACGCTCAACTCCCTCACACAAGAAACGGACTTTTTCTCCTACTAT
CGCCTCAACCTGTTCAATAGACAATGTCCCTTCTGGAACGACGCCAATAGCATGTGTGGCAACATTGCCTGTGCC
GTGAACACTATCGACTCAGAGGAGGATATTCCGCTGACGTGGCGCGCGGAAGAACTCAGCAAACTAGAGGGCCCG
AAGGCGAACCACCCACCTCGCAATATTCAAGCCGAGCGGCCGAAAGAACGCCCGCTACAGGGAGAGCTGGGTGAA
GATGTCGGCGAGAGCTGTGTGGTGGAATATGATGACGAATGTGAGGAACGAGACTACTGTGTCCCCGAGGACGAG
GGTTCCGCCGGGAAAGGAGACTATGTGAGCTTGGTGGATAATCCGGAGCGGTTCACGGGATACTCTGGAGAAGGT
GCAAACCAAGTGTGGGATGCCATCTACCGCGAAAACTGCTTCTTGAAGCCCGTGGCTGAGGAGCTGGAGGAGCAG
TCGGTCAACGTTCCAATAGGCGGCCTCCAGGCAGCCTCTGACTTCCGCGACGTTCTCCAAAAGGAATCGCAGCGG
GTAGAAAGCCTGTCGCTTGATAACGAGTGCTTGGAGAAGCGAGTCTTCCACCGGCTGCTGAGCGGCATGCACGCT
TCTATCTCGACCCATCTGTGCTGGGACTACCTCAACCAAACCACCGGCCTGTGGCACCCCAACGTGCAATGCTTC
AAGGATCGACTCCTTGACCACCCGGAGCGCATCTCAAACATGTACTTCAACTACGCACTAGTCTCGCGCGCCGTG
GCCAAACTCCGTAAGCACCTGGACGGGTACACATACTGCGCCAGCGACCCAGTGCAAGACCGTGAGACCAAAAAG
CGCGTCAACAAGCTAACAGCGACCTTGACGGAGCTTCCTCAAATCTTCGACGAGAAGATCATGTTCCAGGACGCC
AACGCCATCGGCCTGAAAGAAGACTTCCGCAACCGCTTCCGCAACGTCAGTCGCCTTATGGACTGCGTCGGCTGC
GACAAGTGCCGCCTCTGGGGCAAGCTCCAGGTAAACGGGTACGGAACCGCGCTCAAGGTGTTGTTCGAGTACGAC
GAAACCAAGAACGGCGAGAACCCGCCCCTGCGCCGCACCGAGCTGGTCGCTCTCATCAACACACTCGGCCGCATC
TCGCACAGTATCGCTGCTTCGCGCAGTATGCAGCGCGCTCTGCTGACCGGCACCACCCACATGTTCCCCGTCCAC
GGCGCCGTACCCTCCTCTCACCACGCCAACGCCCTCGGCGACAACAGACGCGTGTTCAGCGACGGCAATAACAAC
TTCTATTTCGAAGGTGAAGATAACGAAGATGATTATGTCTACGGCCGAGGCGCCGCGCCAGAACGGTACCCCTGG
GAGCGCAAACCGCCTGGCCCAGACGATGGCTGGGTCGAGGATTTCATGTCCGAGTGGAATATGATCTGGGGTACG
GTTGGGTATATCTGGCAGTCTTGGTTGGACATCCCATTTACAATTTACCAAATCGGCACGTCGGAGTTCATCCGA
CTGTACAATTATTGGCTCGGATTGCCGGTGCCTCCTCGCATGTGGAAGCTGAAGACGCCGCAGCCGCGTGCACAT
ACTCAACCTGCTGCCTATGCTAATCGTGACGAGTTATGA
Transcript >Pro_DTO377G3_2|g7867.t1
ATGCGGTCTGCAGCGAGGCTGCTCTATGCAGCAGTGTTTGCGCTTGCTAGCTTGAGCCATGCCGCCGTTCATAAT
CCTGCATTGGACCCAACTAAGTGTGCTATCGAACCTTCGGCCATGGTATCCGATGCGTGTGTCACATACGGCGAG
ATCAACGGCATGAATGACCTGATTTTCACGACGCTCAACTCCCTCACACAAGAAACGGACTTTTTCTCCTACTAT
CGCCTCAACCTGTTCAATAGACAATGTCCCTTCTGGAACGACGCCAATAGCATGTGTGGCAACATTGCCTGTGCC
GTGAACACTATCGACTCAGAGGAGGATATTCCGCTGACGTGGCGCGCGGAAGAACTCAGCAAACTAGAGGGCCCG
AAGGCGAACCACCCACCTCGCAATATTCAAGCCGAGCGGCCGAAAGAACGCCCGCTACAGGGAGAGCTGGGTGAA
GATGTCGGCGAGAGCTGTGTGGTGGAATATGATGACGAATGTGAGGAACGAGACTACTGTGTCCCCGAGGACGAG
GGTTCCGCCGGGAAAGGAGACTATGTGAGCTTGGTGGATAATCCGGAGCGGTTCACGGGATACTCTGGAGAAGGT
GCAAACCAAGTGTGGGATGCCATCTACCGCGAAAACTGCTTCTTGAAGCCCGTGGCTGAGGAGCTGGAGGAGCAG
TCGGTCAACGTTCCAATAGGCGGCCTCCAGGCAGCCTCTGACTTCCGCGACGTTCTCCAAAAGGAATCGCAGCGG
GTAGAAAGCCTGTCGCTTGATAACGAGTGCTTGGAGAAGCGAGTCTTCCACCGGCTGCTGAGCGGCATGCACGCT
TCTATCTCGACCCATCTGTGCTGGGACTACCTCAACCAAACCACCGGCCTGTGGCACCCCAACGTGCAATGCTTC
AAGGATCGACTCCTTGACCACCCGGAGCGCATCTCAAACATGTACTTCAACTACGCACTAGTCTCGCGCGCCGTG
GCCAAACTCCGTAAGCACCTGGACGGGTACACATACTGCGCCAGCGACCCAGTGCAAGACCGTGAGACCAAAAAG
CGCGTCAACAAGCTAACAGCGACCTTGACGGAGCTTCCTCAAATCTTCGACGAGAAGATCATGTTCCAGGACGCC
AACGCCATCGGCCTGAAAGAAGACTTCCGCAACCGCTTCCGCAACGTCAGTCGCCTTATGGACTGCGTCGGCTGC
GACAAGTGCCGCCTCTGGGGCAAGCTCCAGGTAAACGGGTACGGAACCGCGCTCAAGGTGTTGTTCGAGTACGAC
GAAACCAAGAACGGCGAGAACCCGCCCCTGCGCCGCACCGAGCTGGTCGCTCTCATCAACACACTCGGCCGCATC
TCGCACAGTATCGCTGCTTCGCGCAGTATGCAGCGCGCTCTGCTGACCGGCACCACCCACATGTTCCCCGTCCAC
GGCGCCGTACCCTCCTCTCACCACGCCAACGCCCTCGGCGACAACAGACGCGTGTTCAGCGACGGCAATAACAAC
TTCTATTTCGAAGGTGAAGATAACGAAGATGATTATGTCTACGGCCGAGGCGCCGCGCCAGAACGGTACCCCTGG
GAGCGCAAACCGCCTGGCCCAGACGATGGCTGGGTCGAGGATTTCATGTCCGAGTGGAATATGATCTGGGGTACG
GTTGGGTATATCTGGCAGTCTTGGTTGGACATCCCATTTACAATTTACCAAATCGGCACGTCGGAGTTCATCCGA
CTGTACAATTATTGGCTCGGATTGCCGGTGCCTCCTCGCATGTGGAAGCTGAAGACGCCGCAGCCGCGTGCACAT
ACTCAACCTGCTGCCTATGCTAATCGTGACGAGTTATGA
Gene >Pro_DTO377G3_2|g7867.t1
ATGCGGTCTGCAGCGAGGCTGCTCTATGCAGCAGTGTTTGCGCTTGCTAGCTTGAGCCATGCCGCCGTTCATAAT
CCTGCATTGGACCCAACTAAGTGTGCTGTAAGTCTTATCAGGACCGAGGATACCAACACAGATGACTGACAGTAC
CTAGATCGAACCTTCGGCCATGGTATCCGATGCGTGTGTCACATACGGCGAGATCAACGGCATGAATGACCTGAT
TTTCACGACGCTCAACTCCCTCACACAAGAAACGGACTTTTTCTCCTACTATCGCCTCAACCTGTTCAATAGACA
ATGTCCCTTCTGGAACGACGCCAATAGCATGTGTGGCAACATTGCCTGTGCCGTGAACACTATCGACTCAGAGGA
GGATATTCCGCTGACGTGGCGCGCGGAAGAACTCAGCAAACTAGAGGGCCCGAAGGCGAACCACCCACCTCGCAA
TATTCAAGCCGAGCGGCCGAAAGAACGCCCGCTACAGGGAGAGCTGGGTGAAGATGTCGGCGAGAGCTGTGTGGT
GGAATATGATGACGAATGTGAGGAACGAGACTACTGTGTCCCCGAGGACGAGGGTTCCGCCGGGAAAGGAGACTA
TGTGAGCTTGGTGGATAATCCGGAGCGGTTCACGGGATACTCTGGAGAAGGTGCAAACCAAGTGTGGGATGCCAT
CTACCGCGAAAACTGCTTCTTGAAGCCCGTGGCTGAGGAGCTGGAGGAGCAGTCGGTCAACGTTCCAATAGGCGG
CCTCCAGGCAGCCTCTGACTTCCGCGACGTTCTCCAAAAGGAATCGCAGCGGGTAGAAAGCCTGTCGCTTGATAA
CGAGTGCTTGGAGAAGCGAGTCTTCCACCGGCTGCTGAGCGGCATGCACGCTTCTATCTCGACCCATCTGTGCTG
GGACTACCTCAACCAAACCACCGGCCTGTGGCACCCCAACGTGCAATGCTTCAAGGATCGACTCCTTGACCACCC
GGAGCGCATCTCAAACATGTACTTCAACTACGCACTAGTCTCGCGCGCCGTGGCCAAACTCCGTAAGCACCTGGA
CGGGTACACATACTGCGCCAGCGACCCAGTGCAAGACCGTGAGACCAAAAAGCGCGTCAACAAGCTAACAGCGAC
CTTGACGGAGCTTCCTCAAATCTTCGACGAGAAGATCATGTTCCAGGACGCCAACGCCATCGGCCTGAAAGAAGA
CTTCCGCAACCGCTTCCGCAACGTCAGTCGCCTTATGGACTGCGTCGGCTGCGACAAGTGCCGCCTCTGGGGCAA
GCTCCAGGTAAACGGGTACGGAACCGCGCTCAAGGTGTTGTTCGAGTACGACGAAACCAAGAACGGCGAGAACCC
GCCCCTGCGCCGCACCGAGCTGGTCGCTCTCATCAACACACTCGGCCGCATCTCGCACAGTATCGCTGCTTCGCG
CAGTATGCAGCGCGCTCTGCTGACCGGCACCACCCACATGTTCCCCGTCCACGGCGCCGTACCCTCCTCTCACCA
CGCCAACGCCCTCGGCGACAACAGACGCGTGTTCAGCGACGGCAATAACAACTTCTATTTCGAAGGTGAAGATAA
CGAAGATGATTATGTCTACGGCCGAGGCGCCGCGCCAGAACGGTACCCCTGGGAGCGCAAACCGCCTGGCCCAGA
CGATGGCTGGGTCGAGGATTTCATGTCCGAGTGGAATATGATCTGGGGTACGGTTGGGTATATCTGGCAGTCTTG
GTTGGACATCCCATTTACAATGTAAGTTGCTCTTGATCTGGTTATTGGATAGACTGACTGACTCTTGCAGTTACC
AAATCGGCACGTCGGAGTTCATCCGACTGTACAATTATTGGCTCGGATTGCCGGTGCCTCCTCGCATGTGGAAGC
TGAAGACGCCGCAGCCGCGTGCACATACTCAACCTGCTGCCTATGCTAATCGTGACGAGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail