Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7857.t1
Gene name
Locationscaffold_26:287606..289284
Strand+
Gene length (bp)1678
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16862 Glyco_hydro_79C Glycosyl hydrolase family 79 C-terminal beta domain 7.5E-22 372 475

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 3.81 1.01 6.60
5d_25C Five days - 25 degrees Celsius 3.70 1.01 6.39
7d_25C Seven days - 25 degrees Celsius 3.53 0.91 6.16
10d_25C Ten days - 25 degrees Celsius 3.49 0.87 6.10
7d_15C Seven days - 15 degrees Celsius 12.14 5.07 19.22
7d_30C Seven days - 30 degrees Celsius 4.43 1.33 7.52

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.967163 no
3d_25C 7d_25C 0.909550 no
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.780998 no
3d_25C 10d_25C 0.888830 no
5d_25C 7d_25C 0.945255 no
5d_25C 7d_15C 0.000700 yes
5d_25C 7d_30C 0.733168 no
5d_25C 10d_25C 0.926755 no
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.647233 no
7d_25C 10d_25C 0.984553 no
7d_15C 7d_30C 0.001804 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.622896 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7857.t1
MTSIPISALLLGLAASALSLSFNVPISPPSNSSQQLSAAPVGVSLEFFAFPEYIQEVESTMTCLQNLKDLTGTWP
PMRIGGTTQDRAIYNSSSTEAVTYTVASTGAAPETLTYGPSFISLAAGYAGEVIIGLNRRLDDILNTISAALLAQ
SKMNNLYSIELGNEPNFFVDSDPIANGVSWTAAADESSQVTWQDAMCGNLSATDIISAGVYFGTSPMSLASLTAK
ESDANDYVKDYCSHNYPQSSGSYDLATLMGHSSIATQIKPYATEVSAAAEKGKPHIFGETNSATQGGGGISPTFG
AALWILDYVMQTVLMGTNALYFHQGTVGNCQYCWWGRYDIGSPYYGAYFASMALANADQIAPLDSQDTAYAAYAL
YKASVPVRVLLYNSDYYISTSGTRSSQIYTLSGLFSSGVTAKRLTAPYATSRVDQGQNPTVAGQTFANGTCIIQG
IESIETVTVSGGKATFTVAASEALLVYL*
Coding >Pro_DTO377G3_2|g7857.t1
ATGACATCAATTCCCATCTCAGCCTTGCTTCTAGGCCTCGCGGCTTCGGCTTTGAGTTTGAGCTTCAATGTTCCG
ATATCCCCGCCTTCAAATTCTAGCCAGCAGCTCTCTGCAGCTCCAGTTGGTGTATCTCTGGAGTTCTTTGCGTTC
CCTGAGTACATTCAAGAGGTCGAATCAACGATGACATGTCTGCAGAACCTCAAGGATCTGACAGGAACATGGCCT
CCTATGCGGATCGGAGGCACAACACAGGACCGCGCGATATACAATAGCTCATCAACGGAAGCTGTCACTTATACA
GTGGCCAGCACAGGTGCTGCGCCCGAGACTCTGACTTACGGACCGTCCTTCATCTCTTTGGCTGCAGGCTATGCC
GGAGAAGTTATAATTGGATTGAATCGTCGTTTGGACGATATCTTGAACACAATTTCGGCCGCGCTTCTCGCCCAG
AGCAAAATGAACAATCTATACTCCATTGAACTGGGGAATGAGCCCAACTTTTTCGTTGACAGCGATCCTATTGCC
AATGGTGTATCCTGGACAGCTGCAGCTGATGAATCATCCCAAGTCACCTGGCAAGATGCGATGTGCGGAAATCTC
TCTGCAACTGATATCATCTCAGCAGGTGTCTACTTTGGCACTTCGCCCATGAGCCTCGCTAGCCTTACCGCGAAA
GAGAGTGATGCGAATGACTATGTGAAGGATTATTGCTCTCACAACTATCCCCAGTCATCTGGCTCCTACGACCTT
GCTACTCTTATGGGCCACAGCAGTATTGCCACCCAGATCAAGCCTTATGCTACTGAAGTTTCTGCAGCTGCTGAA
AAAGGCAAACCGCATATCTTCGGCGAGACTAACTCGGCAACCCAAGGCGGTGGTGGTATCAGCCCGACTTTTGGT
GCTGCGCTCTGGATCTTGGACTACGTGATGCAGACCGTCCTCATGGGCACAAATGCCCTCTACTTCCACCAGGGT
ACCGTTGGAAACTGCCAATACTGCTGGTGGGGCCGCTACGACATAGGATCCCCTTACTACGGTGCTTACTTCGCC
AGCATGGCGCTCGCCAACGCCGACCAGATTGCGCCTCTGGATAGCCAAGATACAGCATATGCAGCCTACGCCCTC
TACAAGGCTAGCGTTCCTGTCCGGGTCCTTCTCTACAATTCCGACTACTATATATCTACCAGCGGAACACGGTCC
TCGCAAATATATACACTGTCTGGGCTTTTTTCCTCAGGCGTTACTGCTAAACGACTGACTGCTCCCTATGCTACG
TCTCGGGTCGATCAGGGTCAGAACCCGACCGTTGCGGGCCAGACATTTGCCAACGGCACTTGCATTATTCAGGGT
ATAGAGAGCATAGAGACAGTCACTGTCTCTGGCGGGAAAGCAACCTTCACTGTTGCAGCTTCGGAAGCTCTTCTG
GTTTACCTGTAA
Transcript >Pro_DTO377G3_2|g7857.t1
ATGACATCAATTCCCATCTCAGCCTTGCTTCTAGGCCTCGCGGCTTCGGCTTTGAGTTTGAGCTTCAATGTTCCG
ATATCCCCGCCTTCAAATTCTAGCCAGCAGCTCTCTGCAGCTCCAGTTGGTGTATCTCTGGAGTTCTTTGCGTTC
CCTGAGTACATTCAAGAGGTCGAATCAACGATGACATGTCTGCAGAACCTCAAGGATCTGACAGGAACATGGCCT
CCTATGCGGATCGGAGGCACAACACAGGACCGCGCGATATACAATAGCTCATCAACGGAAGCTGTCACTTATACA
GTGGCCAGCACAGGTGCTGCGCCCGAGACTCTGACTTACGGACCGTCCTTCATCTCTTTGGCTGCAGGCTATGCC
GGAGAAGTTATAATTGGATTGAATCGTCGTTTGGACGATATCTTGAACACAATTTCGGCCGCGCTTCTCGCCCAG
AGCAAAATGAACAATCTATACTCCATTGAACTGGGGAATGAGCCCAACTTTTTCGTTGACAGCGATCCTATTGCC
AATGGTGTATCCTGGACAGCTGCAGCTGATGAATCATCCCAAGTCACCTGGCAAGATGCGATGTGCGGAAATCTC
TCTGCAACTGATATCATCTCAGCAGGTGTCTACTTTGGCACTTCGCCCATGAGCCTCGCTAGCCTTACCGCGAAA
GAGAGTGATGCGAATGACTATGTGAAGGATTATTGCTCTCACAACTATCCCCAGTCATCTGGCTCCTACGACCTT
GCTACTCTTATGGGCCACAGCAGTATTGCCACCCAGATCAAGCCTTATGCTACTGAAGTTTCTGCAGCTGCTGAA
AAAGGCAAACCGCATATCTTCGGCGAGACTAACTCGGCAACCCAAGGCGGTGGTGGTATCAGCCCGACTTTTGGT
GCTGCGCTCTGGATCTTGGACTACGTGATGCAGACCGTCCTCATGGGCACAAATGCCCTCTACTTCCACCAGGGT
ACCGTTGGAAACTGCCAATACTGCTGGTGGGGCCGCTACGACATAGGATCCCCTTACTACGGTGCTTACTTCGCC
AGCATGGCGCTCGCCAACGCCGACCAGATTGCGCCTCTGGATAGCCAAGATACAGCATATGCAGCCTACGCCCTC
TACAAGGCTAGCGTTCCTGTCCGGGTCCTTCTCTACAATTCCGACTACTATATATCTACCAGCGGAACACGGTCC
TCGCAAATATATACACTGTCTGGGCTTTTTTCCTCAGGCGTTACTGCTAAACGACTGACTGCTCCCTATGCTACG
TCTCGGGTCGATCAGGGTCAGAACCCGACCGTTGCGGGCCAGACATTTGCCAACGGCACTTGCATTATTCAGGGT
ATAGAGAGCATAGAGACAGTCACTGTCTCTGGCGGGAAAGCAACCTTCACTGTTGCAGCTTCGGAAGCTCTTCTG
GTTTACCTGTAA
Gene >Pro_DTO377G3_2|g7857.t1
ATGACATCAATTCCCATCTCAGCCTTGCTTCTAGGCCTCGCGGCTTCGGCTTTGAGTTTGAGCTTCAATGTTCCG
ATATCCCCGCCTTCAAATTCTAGCCAGCAGCTCTCTGCAGCTCCAGTTGGTGTATCGTGAGTCTCTATCTAAGCC
ATTGGCAGATATAATTACTCACCGTGAAGTCTGGAGTTCTTTGCGTTCCCTGAGTACATTCAAGAGGTCGAATCA
ACGATGACATGTCTGCAGAACCTCAAGGATCTGACAGGAACATGGCCTCCTATGCGGATCGGAGGCACAACACAG
TATGTATGCTTTTATTGGTCAATAAATGTTGTTAACAGTACGCAGGGACCGCGCGATATACAATAGCTCATCAAC
GGAAGCTGTCACTTATACAGTGGCCAGCACAGGTGCTGCGCCCGAGACTCTGACTTACGGACCGTCCTTCATCTC
TTTGGCTGCAGGCTATGCCGGAGAAGTTATAATTGGATTGAATCGTCGTTTGGACGATATCTTGAACACAATTTC
GGCCGCGCTTCTCGCCCAGAGCAAAATGAACAATCTATACTCCATTGAACTGGGGAATGAGCCCAACTGTAGGTC
TCAAATTACTTATTCTTGGTTGTGTAGACGCTAATTAAGCGTTCAGTTTTCGTTGACAGCGATCCTATTGCCAAT
GGTGTATCCTGGACAGCTGCAGCTGATGAATCATCCCAAGTCACCTGGCAAGATGCGATGTGCGGAAATCTCTCT
GCAACTGATATCATCTCAGCAGGTGTCTACTTTGGCACTTCGCCCATGAGCCTCGCTAGCCTTACCGCGAAAGAG
AGTGATGCGAATGACTATGTGAAGGATTATTGCTCTCACAACTATCCCCAGTCATCTGGCTCCTACGACCTTGCT
ACTCTTATGGGCCACAGCAGTATTGCCACCCAGATCAAGCCTTATGCTACTGAAGTTTCTGCAGCTGCTGAAAAA
GGCAAACCGCATATCTTCGGCGAGACTAACTCGGGTACGTTACTGCTCACTGTCACTTGATAAAAATACTAAAAA
TATTCAGCAACCCAAGGCGGTGGTGGTATCAGCCCGACTTTTGGTGCTGCGCTCTGGATCTTGGACTACGTGATG
CAGACCGTCCTCATGGGCACAAATGCCCTCTACTTCCACCAGGGTACCGTTGGAAACTGTAAGTTATCTAGAACT
TCTTACCCACCCACAAGCTAACTTTCAAGGCCAATACTGCTGGTGGGGCCGCTACGACATAGGATCCCCTTACTA
CGGTGCTTACTTCGCCAGCATGGCGCTCGCCAACGCCGACCAGATTGCGCCTCTGGATAGCCAAGATACAGCATA
TGCAGCCTACGCCCTCTACAAGGCTAGCGTTCCTGTCCGGGTCCTTCTCTACAATTCCGACTACTATATATCTAC
CAGCGGAACACGGTCCTCGCAAATATATACACTGTCTGGGCTTTTTTCCTCAGGCGTTACTGCTAAACGACTGAC
TGCTCCCTATGCTACGTCTCGGGTCGATCAGGGTCAGAACCCGACCGTTGCGGGCCAGACATTTGCCAACGGCAC
TTGCATTATTCAGGGTATAGAGAGCATAGAGACAGTCACTGTCTCTGGCGGGAAAGCAACCTTCACTGTTGCAGC
TTCGGAAGCTCTTCTGGTTTACCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail