Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g785.t1
Gene name
Locationscaffold_01:2099903..2100869
Strand-
Gene length (bp)966
Transcript length (bp)813
Coding sequence length (bp)813
Protein length (aa) 271

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 3.2E-25 91 238

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 129.08 78.18 179.98
5d_25C Five days - 25 degrees Celsius 278.26 169.70 386.81
7d_25C Seven days - 25 degrees Celsius 350.55 210.83 490.27
10d_25C Ten days - 25 degrees Celsius 588.21 343.31 833.10
7d_15C Seven days - 15 degrees Celsius 159.08 96.80 221.37
7d_30C Seven days - 30 degrees Celsius 324.71 197.10 452.32

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.396418 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.335541 no
5d_25C 7d_15C 0.004840 yes
5d_25C 7d_30C 0.550830 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.797706 no
7d_25C 10d_25C 0.010735 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.002297 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g785.t1
MSATMTITSPPEITADNVATLFPEVDTSLAREVLPISQTNTARGSELEGYDEEQVRLMDEVCIVLDNNDRPIGSA
SKKICHLMTNIDKGLLHRAFSVFLFDSNKRLLLQQRATEKITFPDMWTNTCCSHPLGIPGETGAELDAAVLGVKR
AAQRKLDHELGIKAEQVPLDKFEFFTRIHYKAPSDGKWGEHEVDYILFIQADVDLDPSPNEVRDTTYVSADELKA
MFEQPGLTFTPWFKLICNSMLFEWWSHLGTPALEKYKNEREIRRM*
Coding >Pro_DTO377G3_2|g785.t1
ATGAGCGCAACCATGACAATCACAAGCCCGCCTGAGATCACGGCGGACAATGTCGCCACTCTCTTTCCCGAGGTC
GATACATCGCTCGCCCGTGAGGTCCTCCCGATAAGCCAAACAAACACTGCGCGCGGCAGCGAACTAGAGGGATAC
GATGAAGAGCAGGTCCGCCTGATGGACGAGGTCTGCATTGTTTTGGATAACAATGACCGGCCGATTGGAAGCGCC
AGCAAGAAGATTTGCCATTTAATGACCAACATCGACAAGGGTCTCCTTCATCGTGCCTTTTCAGTTTTCCTTTTC
GACTCCAATAAGCGTCTTCTGCTCCAACAGCGCGCCACCGAGAAGATCACCTTCCCTGATATGTGGACCAACACT
TGCTGCTCACACCCCCTTGGCATTCCCGGCGAGACTGGAGCTGAGCTCGATGCTGCCGTACTGGGTGTGAAGCGT
GCTGCGCAGCGCAAGCTGGACCACGAACTGGGCATTAAGGCAGAGCAAGTACCCCTGGACAAATTTGAATTCTTC
ACCCGAATTCACTACAAGGCCCCCAGCGATGGAAAGTGGGGTGAGCACGAGGTGGACTATATCCTCTTCATCCAG
GCCGATGTCGATCTGGATCCCAGCCCCAACGAGGTCCGAGACACCACCTACGTCTCAGCTGATGAGCTTAAGGCA
ATGTTCGAGCAGCCCGGTTTGACATTTACCCCCTGGTTCAAGCTTATCTGCAACTCCATGCTCTTCGAGTGGTGG
AGCCACCTCGGTACACCAGCCCTGGAGAAGTACAAGAATGAGCGGGAAATCCGTCGGATGTAA
Transcript >Pro_DTO377G3_2|g785.t1
ATGAGCGCAACCATGACAATCACAAGCCCGCCTGAGATCACGGCGGACAATGTCGCCACTCTCTTTCCCGAGGTC
GATACATCGCTCGCCCGTGAGGTCCTCCCGATAAGCCAAACAAACACTGCGCGCGGCAGCGAACTAGAGGGATAC
GATGAAGAGCAGGTCCGCCTGATGGACGAGGTCTGCATTGTTTTGGATAACAATGACCGGCCGATTGGAAGCGCC
AGCAAGAAGATTTGCCATTTAATGACCAACATCGACAAGGGTCTCCTTCATCGTGCCTTTTCAGTTTTCCTTTTC
GACTCCAATAAGCGTCTTCTGCTCCAACAGCGCGCCACCGAGAAGATCACCTTCCCTGATATGTGGACCAACACT
TGCTGCTCACACCCCCTTGGCATTCCCGGCGAGACTGGAGCTGAGCTCGATGCTGCCGTACTGGGTGTGAAGCGT
GCTGCGCAGCGCAAGCTGGACCACGAACTGGGCATTAAGGCAGAGCAAGTACCCCTGGACAAATTTGAATTCTTC
ACCCGAATTCACTACAAGGCCCCCAGCGATGGAAAGTGGGGTGAGCACGAGGTGGACTATATCCTCTTCATCCAG
GCCGATGTCGATCTGGATCCCAGCCCCAACGAGGTCCGAGACACCACCTACGTCTCAGCTGATGAGCTTAAGGCA
ATGTTCGAGCAGCCCGGTTTGACATTTACCCCCTGGTTCAAGCTTATCTGCAACTCCATGCTCTTCGAGTGGTGG
AGCCACCTCGGTACACCAGCCCTGGAGAAGTACAAGAATGAGCGGGAAATCCGTCGGATGTAA
Gene >Pro_DTO377G3_2|g785.t1
ATGAGCGCAACCATGACAATCACAAGCCCGCCTGAGATCACGGCGGACAATGTCGCCACTCTCTTTCCCGAGGTC
GATACATCGCTCGCCCGTGAGGTCCTCCCGATAAGCCAAACAAACACTGCGCGCGGCAGCGAACTAGAGGGATAC
GATGAAGAGCAGGTCCGCCTGATGGACGAGGTCTGCATTGTTTTGGATAACAATGACCGGCCGATTGGAAGCGCC
AGCAAGAAGATTTGTATGTTTCGCATCCTATAATCACCCACAGATGTACAGAATGGCGGGGTAGTGGACACAACA
TGGCAAGATAAAAACACTGACAGTTGCATTTGCATAGGCCATTTAATGACCAACATCGACAAGGGTCTCCTTCAT
CGTGCCTTTTCAGTTTTCCTTTTCGACTCCAATAAGCGTCTTCTGCTCCAACAGCGCGCCACCGAGAAGATCACC
TTCCCTGATATGTGGACCAACACTTGCTGCTCACACCCCCTTGGCATTCCCGGCGAGACTGGAGCTGAGCTCGAT
GCTGCCGTACTGGGTGTGAAGCGTGCTGCGCAGCGCAAGCTGGACCACGAACTGGGCATTAAGGCAGAGCAAGTA
CCCCTGGACAAATTTGAATTCTTCACCCGAATTCACTACAAGGCCCCCAGCGATGGAAAGTGGGGTGAGCACGAG
GGTATGTTACATGCAATATAGATCTGATTCGATGGAAATACTGACATTTTGCTAGTGGACTATATCCTCTTCATC
CAGGCCGATGTCGATCTGGATCCCAGCCCCAACGAGGTCCGAGACACCACCTACGTCTCAGCTGATGAGCTTAAG
GCAATGTTCGAGCAGCCCGGTTTGACATTTACCCCCTGGTTCAAGCTTATCTGCAACTCCATGCTCTTCGAGTGG
TGGAGCCACCTCGGTACACCAGCCCTGGAGAAGTACAAGAATGAGCGGGAAATCCGTCGGATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail