Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7848.t1
Gene name
Locationscaffold_26:269267..270380
Strand-
Gene length (bp)1113
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain 1.7E-31 136 360
PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold 1.1E-24 3 112

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.49 0.10 2.89
5d_25C Five days - 25 degrees Celsius 1.07 0.00 2.26
7d_25C Seven days - 25 degrees Celsius 0.77 0.00 1.67
10d_25C Ten days - 25 degrees Celsius 0.97 0.00 2.03
7d_15C Seven days - 15 degrees Celsius 1.65 0.12 3.19
7d_30C Seven days - 30 degrees Celsius 2.71 0.35 5.07

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.634249 no
3d_25C 7d_25C 0.305517 no
3d_25C 7d_15C 0.890335 no
3d_25C 7d_30C 0.245345 no
3d_25C 10d_25C 0.506152 no
5d_25C 7d_25C 0.698575 no
5d_25C 7d_15C 0.506338 no
5d_25C 7d_30C 0.105675 no
5d_25C 10d_25C 0.916844 no
7d_25C 7d_15C 0.226353 no
7d_25C 7d_30C 0.042821 yes
7d_25C 10d_25C 0.799730 no
7d_15C 7d_30C 0.363341 no
7d_15C 10d_25C 0.397116 no
7d_30C 10d_25C 0.072166 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7848.t1
MSVKVAIIGAGLIGPRHAQSVISNPSTELIALVDPMPAGEATASSLKTNYYPSVASLLASPHRPDAAIVCTPNHT
HVPVAKELLAGGIHVLLEKPVSDTLETGRSLLEFAQAPERAHLKLLVGHHRRFNPYVRATKAALDAGSLGRPIAI
NGLWTLFKPDPYFAPPTDWRASNERGGGVIPINLVHDIDLMHHFFGPIVRVTAERTLPQRPSPPHNADEGAALTL
RFASGVVGTFLVCDATPSPHNFETGTGENPLIPRTTTGGDSDFYRIFGSDASLSVPDLTRWSYDASPEKSWNSPL
TVERIPLPDDKAPFDLQLAHFVDVINGDAAPSCTGEEGLRALIVCEAVQKAIWSGQPVDIDVNLLAKSDD*
Coding >Pro_DTO377G3_2|g7848.t1
ATGTCCGTCAAGGTTGCCATTATCGGCGCAGGCCTTATTGGCCCTCGTCATGCGCAATCCGTAATCTCAAACCCC
TCAACAGAGCTAATTGCGCTCGTTGACCCAATGCCGGCTGGCGAAGCAACCGCATCCAGTCTTAAAACCAACTAC
TACCCTTCTGTGGCCTCACTACTTGCATCCCCCCACCGTCCCGACGCAGCAATCGTCTGCACACCAAACCACACC
CACGTCCCCGTCGCAAAGGAGCTCCTTGCAGGTGGTATCCACGTTCTCCTTGAAAAGCCCGTAAGCGATACGCTG
GAAACTGGCCGCTCCCTACTAGAGTTTGCCCAAGCCCCAGAGCGCGCCCACCTCAAGCTCCTAGTCGGCCACCAC
CGCCGCTTCAATCCTTACGTGCGAGCTACGAAGGCCGCCCTAGATGCTGGATCTCTCGGCCGCCCCATTGCTATC
AACGGTCTGTGGACCTTGTTCAAGCCAGATCCATATTTCGCCCCGCCAACAGACTGGCGTGCATCGAATGAGCGC
GGAGGTGGTGTCATCCCCATCAACCTTGTCCACGACATCGACCTCATGCACCACTTTTTCGGGCCTATCGTGCGC
GTGACAGCAGAGCGCACGCTGCCACAGCGCCCAAGCCCACCACACAATGCTGATGAAGGTGCTGCCCTGACGCTG
CGCTTCGCATCGGGTGTTGTCGGCACGTTTCTGGTCTGCGATGCGACGCCGTCGCCGCATAATTTCGAGACTGGT
ACGGGCGAGAACCCGCTCATCCCACGGACGACGACTGGCGGTGACTCTGATTTCTATCGAATCTTTGGCTCGGAT
GCTTCGCTCAGTGTGCCCGACCTGACCCGCTGGAGTTATGATGCTAGCCCTGAGAAGAGCTGGAATTCACCATTG
ACTGTTGAGCGGATTCCGCTTCCAGATGATAAGGCGCCTTTTGACCTGCAGCTTGCGCATTTTGTCGATGTCATC
AATGGAGATGCGGCGCCTAGCTGTACTGGTGAGGAAGGTTTGCGTGCATTGATTGTTTGTGAGGCTGTTCAGAAG
GCTATATGGTCGGGTCAGCCTGTGGATATTGATGTTAACTTGTTGGCAAAATCGGATGACTAG
Transcript >Pro_DTO377G3_2|g7848.t1
ATGTCCGTCAAGGTTGCCATTATCGGCGCAGGCCTTATTGGCCCTCGTCATGCGCAATCCGTAATCTCAAACCCC
TCAACAGAGCTAATTGCGCTCGTTGACCCAATGCCGGCTGGCGAAGCAACCGCATCCAGTCTTAAAACCAACTAC
TACCCTTCTGTGGCCTCACTACTTGCATCCCCCCACCGTCCCGACGCAGCAATCGTCTGCACACCAAACCACACC
CACGTCCCCGTCGCAAAGGAGCTCCTTGCAGGTGGTATCCACGTTCTCCTTGAAAAGCCCGTAAGCGATACGCTG
GAAACTGGCCGCTCCCTACTAGAGTTTGCCCAAGCCCCAGAGCGCGCCCACCTCAAGCTCCTAGTCGGCCACCAC
CGCCGCTTCAATCCTTACGTGCGAGCTACGAAGGCCGCCCTAGATGCTGGATCTCTCGGCCGCCCCATTGCTATC
AACGGTCTGTGGACCTTGTTCAAGCCAGATCCATATTTCGCCCCGCCAACAGACTGGCGTGCATCGAATGAGCGC
GGAGGTGGTGTCATCCCCATCAACCTTGTCCACGACATCGACCTCATGCACCACTTTTTCGGGCCTATCGTGCGC
GTGACAGCAGAGCGCACGCTGCCACAGCGCCCAAGCCCACCACACAATGCTGATGAAGGTGCTGCCCTGACGCTG
CGCTTCGCATCGGGTGTTGTCGGCACGTTTCTGGTCTGCGATGCGACGCCGTCGCCGCATAATTTCGAGACTGGT
ACGGGCGAGAACCCGCTCATCCCACGGACGACGACTGGCGGTGACTCTGATTTCTATCGAATCTTTGGCTCGGAT
GCTTCGCTCAGTGTGCCCGACCTGACCCGCTGGAGTTATGATGCTAGCCCTGAGAAGAGCTGGAATTCACCATTG
ACTGTTGAGCGGATTCCGCTTCCAGATGATAAGGCGCCTTTTGACCTGCAGCTTGCGCATTTTGTCGATGTCATC
AATGGAGATGCGGCGCCTAGCTGTACTGGTGAGGAAGGTTTGCGTGCATTGATTGTTTGTGAGGCTGTTCAGAAG
GCTATATGGTCGGGTCAGCCTGTGGATATTGATGTTAACTTGTTGGCAAAATCGGATGACTAG
Gene >Pro_DTO377G3_2|g7848.t1
ATGTCCGTCAAGGTTGCCATTATCGGCGCAGGCCTTATTGGCCCTCGTCATGCGCAATCCGTAATCTCAAACCCC
TCAACAGAGCTAATTGCGCTCGTTGACCCAATGCCGGCTGGCGAAGCAACCGCATCCAGTCTTAAAACCAACTAC
TACCCTTCTGTGGCCTCACTACTTGCATCCCCCCACCGTCCCGACGCAGCAATCGTCTGCACACCAAACCACACC
CACGTCCCCGTCGCAAAGGAGCTCCTTGCAGGTGGTATCCACGTTCTCCTTGAAAAGCCCGTAAGCGATACGCTG
GAAACTGGCCGCTCCCTACTAGAGTTTGCCCAAGCCCCAGAGCGCGCCCACCTCAAGCTCCTAGTCGGCCACCAC
CGCCGCTTCAATCCTTACGTGCGAGCTACGAAGGCCGCCCTAGATGCTGGATCTCTCGGCCGCCCCATTGCTATC
AACGGTCTGTGGACCTTGTTCAAGCCAGATCCATATTTCGCCCCGCCAACAGACTGGCGTGCATCGAATGAGCGC
GGAGGTGGTGTCATCCCCATCAACCTTGTCCACGACATCGACCTCATGCACCACTTTTTCGGGCCTATCGTGCGC
GTGACAGCAGAGCGCACGCTGCCACAGCGCCCAAGCCCACCACACAATGCTGATGAAGGTGCTGCCCTGACGCTG
CGCTTCGCATCGGGTGTTGTCGGCACGTTTCTGGTCTGCGATGCGACGCCGTCGCCGCATAATTTCGAGACTGGT
ACGGGCGAGAACCCGCTCATCCCACGGACGACGACTGGCGGTGACTCTGATTTCTATCGAATCTTTGGCTCGGAT
GCTTCGCTCAGTGTGCCCGACCTGACCCGCTGGAGTTATGATGCTAGCCCTGAGAAGAGCTGGAATTCACCATTG
ACTGTTGAGCGGATTCCGCTTCCAGATGATAAGGCGCCTTTTGACCTGCAGCTTGCGCATTTTGTCGATGTCATC
AATGGAGATGCGGCGCCTAGCTGTACTGGTGAGGAAGGTTTGCGTGCATTGATTGTTTGTGAGGCTGTTCAGAAG
GCTATATGGTCGGGTCAGCCTGTGGATATTGATGTTAACTTGTTGGCAAAATCGGATGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail