Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g783.t1
Gene name
Locationscaffold_01:2096010..2097955
Strand-
Gene length (bp)1945
Transcript length (bp)1896
Coding sequence length (bp)1896
Protein length (aa) 632

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 8.1E-34 200 359
PF01554 MatE MatE 1.1E-23 425 579

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015297 antiporter activity Yes
GO:0042910 xenobiotic transmembrane transporter activity Yes
GO:0015291 secondary active transmembrane transporter activity No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0022804 active transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

Domain # Start End Length
1 198 220 22
2 230 252 22
3 273 292 19
4 307 327 20
5 340 362 22
6 372 394 22
7 415 437 22
8 447 469 22
9 494 516 22
10 526 543 17
11 564 586 22
12 590 612 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g783.t1
MARNIRSVDSAEYQSPFGRSFTSSSPIAASAIARDLADYSEEDRTPTDEDSDTSTARRIDSYTSTNPRSLAGSYR
RPSYVTSVSHATVVPWAGEQQAISQSERDQVIGEERQLLSDNNIIGQGSRSRRPSGASRRSRSSDHESDAASEIT
ALLRERTSDAEDSGLDSEEIDRKWGEAVAAGLIQTTWQREAKVIMKYSLPLMVTFLLQYSLTVASIFTIGHLGKE
ELGAVSLASMTVTITGNAVYSGLSTSLDTLCAQAYGSGKRKLVGLQMLRMVYFLWVITIPIMFLWYFSEHILAKI
VPEKEVAQMAGLYLKVALLGTPGFALFESGKRYLQAQGVFSASLYVLIFCAPLNAFMNWFFVWKLQWGFIGAPIA
VVITENLLPLCLFIYVYFFVGSECWCGFTRRAFQNWGPMIRLALPGLIMVEAECLAFEILTLASSYLGTSALAAQ
SILATISSITWQIPFPLSIAGSTRIANLIGATLVDAAKTSAKVSFFGAAIVGVFNMVLLSTLRSYIPRLFSSDPE
VVEIVAQVLPLCAAFQLFDALSANCNGILRGLGRQEVGGYIQLFCYYVIAMPLSMGTTFALGWGVMGLWTGVALA
LGLVSLIEATFISRANWNRSVEEAIKRNELT*
Coding >Pro_DTO377G3_2|g783.t1
ATGGCCCGCAACATCCGCTCGGTGGATTCCGCCGAGTATCAAAGCCCATTTGGTCGTTCCTTCACATCCAGCTCG
CCCATTGCCGCCTCAGCAATTGCCCGAGACCTCGCAGACTACAGCGAGGAGGATCGAACACCCACCGATGAAGAT
TCCGACACTTCAACAGCCCGCCGGATCGACAGCTATACCAGCACCAACCCCCGCTCTTTAGCCGGTTCATATCGC
CGCCCGAGTTATGTGACATCTGTCAGCCATGCGACTGTGGTCCCATGGGCTGGGGAACAGCAAGCCATTTCCCAA
AGCGAGCGCGATCAAGTCATCGGAGAGGAACGGCAGCTACTGAGTGACAACAATATTATCGGCCAAGGATCCCGG
TCTCGACGGCCAAGTGGAGCTTCTCGACGCTCGAGAAGCAGTGATCATGAGTCGGACGCGGCAAGCGAAATCACT
GCTCTACTTAGAGAGCGGACTTCCGATGCCGAGGACAGTGGATTGGACTCGGAAGAGATTGATCGGAAATGGGGA
GAGGCCGTCGCAGCCGGTTTGATCCAGACGACATGGCAGCGCGAAGCAAAGGTCATTATGAAATACTCTTTGCCG
CTCATGGTCACTTTCTTACTGCAGTATTCTTTGACTGTGGCTAGTATCTTTACCATTGGCCATCTGGGAAAGGAA
GAGCTTGGAGCTGTCAGTCTGGCGAGTATGACTGTGACAATTACTGGAAATGCGGTGTACTCGGGTCTGTCAACT
AGTTTGGATACCCTCTGTGCGCAGGCCTACGGCTCTGGAAAGAGAAAGTTGGTGGGCCTGCAGATGCTGCGTATG
GTGTATTTCCTTTGGGTTATCACCATTCCGATCATGTTTCTCTGGTATTTCTCTGAGCATATCCTTGCCAAGATC
GTGCCAGAGAAGGAGGTCGCCCAGATGGCGGGTCTGTATTTGAAGGTTGCTCTCTTGGGCACCCCGGGATTCGCT
CTTTTCGAGAGTGGCAAGCGATATCTCCAGGCCCAGGGTGTGTTTTCTGCCTCCCTATATGTCCTCATTTTCTGC
GCGCCACTGAATGCGTTCATGAACTGGTTCTTCGTCTGGAAACTTCAATGGGGCTTCATTGGGGCGCCAATCGCC
GTCGTAATAACCGAAAATCTCCTCCCGCTTTGCCTGTTCATCTATGTTTATTTCTTCGTGGGATCCGAGTGTTGG
TGCGGATTCACCAGACGAGCATTCCAGAACTGGGGCCCAATGATCCGTCTCGCCCTCCCAGGGCTGATCATGGTC
GAGGCAGAGTGCCTGGCATTTGAAATTTTGACGCTGGCATCAAGCTACCTCGGCACATCCGCACTCGCAGCGCAG
TCCATCCTAGCAACAATCTCCAGCATTACATGGCAGATTCCGTTCCCCCTATCTATTGCAGGTAGCACGCGGATA
GCAAATCTGATCGGGGCTACCTTGGTCGATGCCGCAAAGACCTCTGCGAAAGTGAGCTTCTTCGGAGCAGCCATC
GTTGGCGTGTTCAACATGGTCCTTCTCTCGACTTTGCGGTCCTATATCCCTAGGTTGTTCAGCTCCGATCCCGAA
GTCGTCGAAATTGTAGCGCAGGTGCTTCCGCTCTGCGCAGCCTTCCAGCTTTTCGACGCTCTCTCGGCAAACTGC
AACGGTATTCTCCGTGGTCTGGGTCGCCAGGAGGTGGGCGGCTATATCCAACTCTTCTGTTACTATGTGATTGCC
ATGCCGCTTAGTATGGGAACAACCTTTGCTTTGGGTTGGGGTGTTATGGGCTTGTGGACTGGAGTTGCGCTTGCA
TTGGGCCTTGTTTCGCTCATCGAGGCCACCTTTATCAGTCGAGCTAATTGGAATCGCTCGGTCGAGGAAGCTATC
AAGAGGAATGAGTTGACCTAA
Transcript >Pro_DTO377G3_2|g783.t1
ATGGCCCGCAACATCCGCTCGGTGGATTCCGCCGAGTATCAAAGCCCATTTGGTCGTTCCTTCACATCCAGCTCG
CCCATTGCCGCCTCAGCAATTGCCCGAGACCTCGCAGACTACAGCGAGGAGGATCGAACACCCACCGATGAAGAT
TCCGACACTTCAACAGCCCGCCGGATCGACAGCTATACCAGCACCAACCCCCGCTCTTTAGCCGGTTCATATCGC
CGCCCGAGTTATGTGACATCTGTCAGCCATGCGACTGTGGTCCCATGGGCTGGGGAACAGCAAGCCATTTCCCAA
AGCGAGCGCGATCAAGTCATCGGAGAGGAACGGCAGCTACTGAGTGACAACAATATTATCGGCCAAGGATCCCGG
TCTCGACGGCCAAGTGGAGCTTCTCGACGCTCGAGAAGCAGTGATCATGAGTCGGACGCGGCAAGCGAAATCACT
GCTCTACTTAGAGAGCGGACTTCCGATGCCGAGGACAGTGGATTGGACTCGGAAGAGATTGATCGGAAATGGGGA
GAGGCCGTCGCAGCCGGTTTGATCCAGACGACATGGCAGCGCGAAGCAAAGGTCATTATGAAATACTCTTTGCCG
CTCATGGTCACTTTCTTACTGCAGTATTCTTTGACTGTGGCTAGTATCTTTACCATTGGCCATCTGGGAAAGGAA
GAGCTTGGAGCTGTCAGTCTGGCGAGTATGACTGTGACAATTACTGGAAATGCGGTGTACTCGGGTCTGTCAACT
AGTTTGGATACCCTCTGTGCGCAGGCCTACGGCTCTGGAAAGAGAAAGTTGGTGGGCCTGCAGATGCTGCGTATG
GTGTATTTCCTTTGGGTTATCACCATTCCGATCATGTTTCTCTGGTATTTCTCTGAGCATATCCTTGCCAAGATC
GTGCCAGAGAAGGAGGTCGCCCAGATGGCGGGTCTGTATTTGAAGGTTGCTCTCTTGGGCACCCCGGGATTCGCT
CTTTTCGAGAGTGGCAAGCGATATCTCCAGGCCCAGGGTGTGTTTTCTGCCTCCCTATATGTCCTCATTTTCTGC
GCGCCACTGAATGCGTTCATGAACTGGTTCTTCGTCTGGAAACTTCAATGGGGCTTCATTGGGGCGCCAATCGCC
GTCGTAATAACCGAAAATCTCCTCCCGCTTTGCCTGTTCATCTATGTTTATTTCTTCGTGGGATCCGAGTGTTGG
TGCGGATTCACCAGACGAGCATTCCAGAACTGGGGCCCAATGATCCGTCTCGCCCTCCCAGGGCTGATCATGGTC
GAGGCAGAGTGCCTGGCATTTGAAATTTTGACGCTGGCATCAAGCTACCTCGGCACATCCGCACTCGCAGCGCAG
TCCATCCTAGCAACAATCTCCAGCATTACATGGCAGATTCCGTTCCCCCTATCTATTGCAGGTAGCACGCGGATA
GCAAATCTGATCGGGGCTACCTTGGTCGATGCCGCAAAGACCTCTGCGAAAGTGAGCTTCTTCGGAGCAGCCATC
GTTGGCGTGTTCAACATGGTCCTTCTCTCGACTTTGCGGTCCTATATCCCTAGGTTGTTCAGCTCCGATCCCGAA
GTCGTCGAAATTGTAGCGCAGGTGCTTCCGCTCTGCGCAGCCTTCCAGCTTTTCGACGCTCTCTCGGCAAACTGC
AACGGTATTCTCCGTGGTCTGGGTCGCCAGGAGGTGGGCGGCTATATCCAACTCTTCTGTTACTATGTGATTGCC
ATGCCGCTTAGTATGGGAACAACCTTTGCTTTGGGTTGGGGTGTTATGGGCTTGTGGACTGGAGTTGCGCTTGCA
TTGGGCCTTGTTTCGCTCATCGAGGCCACCTTTATCAGTCGAGCTAATTGGAATCGCTCGGTCGAGGAAGCTATC
AAGAGGAATGAGTTGACCTAA
Gene >Pro_DTO377G3_2|g783.t1
ATGGCCCGCAACATCCGCTCGGTGGATTCCGCCGAGTATCAAAGCCCATTTGGTCGTTCCTTCACATCCAGCTCG
CCCATTGCCGCCTCAGCAATTGCCCGAGACCTCGCAGACTACAGCGAGGAGGATCGAACACCCACCGATGAAGAT
TCCGACACTTCAACAGCCCGCCGGATCGACAGCTATACCAGCACCAACCCCCGCTCTTTAGCCGGTTCATATCGC
CGCCCGAGTTATGTGACATCTGTCAGCCATGCGACTGTGGTCCCATGGGCTGGGGAACAGCAAGCCATTTCCCAA
AGCGAGCGCGATCAAGTCATCGGAGAGGAACGGCAGCTACTGAGTGACAACAATATTATCGGCCAAGGATCCCGG
TCTCGACGGCCAAGTGGAGCTTCTCGACGCTCGAGAAGCAGTGATCATGAGTCGGACGCGGCAAGCGAAATCACT
GCTCTACTTAGAGAGCGGACTTCCGATGCCGAGGACAGTGGATTGGACTCGGAAGAGATTGATCGGAAATGGGGA
GAGGCCGTCGCAGCCGGTTTGATCCAGACGACATGGCAGCGCGAAGCAAAGGTCATTATGAAATACTCTTTGCCG
CTCATGGTCACTTTCTTACTGCAGTATTCTTTGACTGTGGCTAGTATCTTTACCATTGGCCATCTGGGAAAGGAA
GAGCTTGGAGCTGTCAGTCTGGCGAGTATGACTGTGACAATTACTGGAAATGCGGTGTACTCGGGTCTGTCAACT
AGTTTGGATACCCTCTGTGCGCAGGCCTACGGCTCTGGAAAGAGAAAGTTGGTGGGCCTGCAGATGCTGCGTATG
GTGTATTTCCTTTGGGTTATCACCATTCCGATCATGTTTCTCTGGTATTTCTCTGAGCATATCCTTGCCAAGATC
GTGCCAGAGAAGGAGGTCGCCCAGATGGCGGGTCTGTATTTGAAGGTTGCTCTCTTGGGCACCCCGGGATTCGCT
CTTTTCGAGAGTGGCAAGCGATATCTCCAGGCCCAGGGTGTGTTTTCTGCCTCCCTATATGTCCTCATTTTCTGC
GCGCCACTGAATGCGTTCATGAACTGGTTCTTCGTCTGGGTAGGTACTTTCCAGCCTTTTACGAGGACAATACTG
ACTTGTATAAAAGAAACTTCAATGGGGCTTCATTGGGGCGCCAATCGCCGTCGTAATAACCGAAAATCTCCTCCC
GCTTTGCCTGTTCATCTATGTTTATTTCTTCGTGGGATCCGAGTGTTGGTGCGGATTCACCAGACGAGCATTCCA
GAACTGGGGCCCAATGATCCGTCTCGCCCTCCCAGGGCTGATCATGGTCGAGGCAGAGTGCCTGGCATTTGAAAT
TTTGACGCTGGCATCAAGCTACCTCGGCACATCCGCACTCGCAGCGCAGTCCATCCTAGCAACAATCTCCAGCAT
TACATGGCAGATTCCGTTCCCCCTATCTATTGCAGGTAGCACGCGGATAGCAAATCTGATCGGGGCTACCTTGGT
CGATGCCGCAAAGACCTCTGCGAAAGTGAGCTTCTTCGGAGCAGCCATCGTTGGCGTGTTCAACATGGTCCTTCT
CTCGACTTTGCGGTCCTATATCCCTAGGTTGTTCAGCTCCGATCCCGAAGTCGTCGAAATTGTAGCGCAGGTGCT
TCCGCTCTGCGCAGCCTTCCAGCTTTTCGACGCTCTCTCGGCAAACTGCAACGGTATTCTCCGTGGTCTGGGTCG
CCAGGAGGTGGGCGGCTATATCCAACTCTTCTGTTACTATGTGATTGCCATGCCGCTTAGTATGGGAACAACCTT
TGCTTTGGGTTGGGGTGTTATGGGCTTGTGGACTGGAGTTGCGCTTGCATTGGGCCTTGTTTCGCTCATCGAGGC
CACCTTTATCAGTCGAGCTAATTGGAATCGCTCGGTCGAGGAAGCTATCAAGAGGAATGAGTTGACCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail