Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7828.t1
Gene name
Locationscaffold_26:211776..219761
Strand+
Gene length (bp)7985
Transcript length (bp)7698
Coding sequence length (bp)7698
Protein length (aa) 2566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.1E-74 39 288
PF00698 Acyl_transf_1 Acyl transferase domain 2.1E-60 563 892
PF08659 KR KR domain 2.2E-49 2174 2354
PF14765 PS-DH Polyketide synthase dehydratase 3.8E-48 949 1266
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.4E-39 297 414
PF08242 Methyltransf_12 Methyltransferase domain 4.3E-20 1444 1549
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 4.5E-16 417 501
PF00106 adh_short short chain dehydrogenase 1.3E-15 2177 2335
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 5.5E-13 1975 2103
PF13649 Methyltransf_25 Methyltransferase domain 2.3E-11 1442 1548
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 4.1E-10 2013 2150
PF08241 Methyltransf_11 Methyltransferase domain 1.6E-09 1444 1551
PF13489 Methyltransf_23 Methyltransferase domain 3.7E-09 1436 1602
PF00550 PP-binding Phosphopantetheine attachment site 1.1E-06 2473 2538
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 7.4E-07 2183 2334
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.3E-05 1431 1562
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 1.9E-05 1858 1914

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7828.t1
MRLQQPSGTGTPVAESANAFLHEAPSEIADNATGDVPKRMAIIGMSCRLPGDVSTAEEFWDLCSRGRSAWSLIPK
NRFNAESFYHPDPDRPGSFNPVGAHFLKEDVGLFDAPFFNITLQEARSMDPQQRIFLECVYEALENAGIPSHEIS
GQKVGVFAGASYPDYEINNTKDITAIPMYAATGTAVALQANRISYYFDLNGPSVTVDTACSSSLSALHLASQSIR
NGECSMAIVGGCHLNITPETFISMTRSRLLSDTGRSYAFDHRGTGFGRGEGAGCIILKSLEDAEAAGDAIRSVII
NSGLNQDGRTRGIAMPNGKAQEELIRQVYKEARIDPSLVGFVEAHGTGTKVGDPLEATALNAVFGKGRTPRQPLL
VGSVKSNIGHTEGTSGVVSVIKTTLALERGFVPPNCNFEKANDEIPMEDWNMKVPKKLMPWPRGKPYASVNNFGF
GGTNAHVILQRGPRHEGDLAANNDPLRRRLYVVSAYDKQAALQLGKSIGTYLDLFPVVFKDSTLDNMAYTLGQRR
TFLPWRLACSAILGQELNASLSNDAVPVRSSKEPTVGFVFTGQGAQWHGMGKELLGTYPVFKKTMQDVDACLKSF
GATFSIIDELLLTDPSASSISAAYMSQPACTAVQLALVDLLSSWGIRPKAVVGHSSGEIAAAYAAGILNFEECVR
VAYSRGVAANLVANDKSIKGGMLAVGASASDIQQILDAMRGNQAVIACVNSESSVTLSGDAEVIDDLQTALDKEG
IFTRRLQVEVAYHSHHMKIVSHEYRCLLGKIAPRDSEVSFHSTVYGKLVPGSTLGASYWVDNLVSRVEFVEGLKS
LITDEQANTPITTLVEIGPHPALQTPVKDIAQKYAPNSNVHYLHTLKRKVDDIEAVQNLAGSLFTQGLNLDFQAI
NFPNLKTTTRKPALLTNLPKYPWNHSERYWFSSRIGDNHFHPQFPRSDILGSLCMENVDFEPRWRNIIRADDHPW
IREHRVHDRTVYPMTGFLAMAMEAISQHAQLHHVTPGKIDIRDIFINRVLTIPDNSSVETILTLKPSRSEAPSKS
VLGWHEFKVFSWTEGRGWDQHCNGFIMVQEAKDVNPVDGSRQELEKTARFTQQALNMRSSCNIPVHIDFLYENIA
NGGVNYGPLFQGLTEASVSRDGQALATLRIPDTKAAMPHGHETPCILHPVTLDLCSQVMWLLRGYGEPGPHTTFV
PSHVKHISVSLSHEISAGTVLQLYGSGSGNESASNPETNRIFATVPSNPANLLIDINGITLVPISNDIKGSTDNS
PDQICYKMQYEPCFDFLSAEDYRQLPRPETDVAQGIERMQQLEYVAEYYLAQMVNSVTEDDLSTFEPHHRQFYLW
AQKTCRKAGTKDALSLDVLEQSRTVDGASELAFKVGELLPKILRGEVDALSVLLEDDGIGRYYSDLDALREAYAN
ASVCVDKMAHQNPTLNIIEIGAGTGGATMPILQSLGGEPGSTPRFGHYTYTDISPGFFEKAKTKFESWRHLMTYQ
TLDVSADPTGQGFTNGTYDVVVACNVLHATTDISQTMANIRGLLKPGGKVILIEETVPRARHFPFALLPGWWLAN
DKFRTDGPLLTVEGWSNVMKENDFSGVDLCVEEYPGASFQSGCLMTSTANIPITGPANAGDVVILGVDSIGTFSS
LSLESGLKEMIGVDPITAVNSDEVDVTGKWCIFLGGMDRSILSHLTQDKFNALQRLLSRARGLLWVVRHSKSDLE
SLGANMAIGLARTVRSETGLQFATLDLGERENMPDAEAVKHMLKVFNGVFCQKSQLAQNDWEFVVRNGNVCVPRL
VDNNTLNLSVQQETPNAPPQMQPFKQDRALRLAAGDGRGLDELYFTDDVSRNGALPEDHIEIQVHSTGLNFRDVL
MAMGQLQGERLGQECSGVVTQVGAAVSDFKIGDRVCAMSPGSLSTFTRCPASGSLLIPDDMSFETSASIPAVFCT
AFYSLIDLGRLSKDESVLIHAAAGGVGQAAIIIAQSIGANIFATVGSLEKKNFLMETYQLKEDHIFFSRDMSFVQ
GIQHATGGQGVDVALNSLSGDALQATFECVAPFGRFIELGKRDITTNSRLEMSHFNKNISFASVDLGMVREKRPQ
LTKRLLRDAFKLFVDTNAQSKWSVTTLPISDVEIGFRALQGGQVIGKIVVQVTDDSMVKVYPARRDENLLRADAS
YIIVGGTGGIGLNIASWMPERGAKNLILVSRSGIKTEKAEQAVQNLIRQGVNVEVCRCDVADQQSVEQDLVPLLA
RMPPARGVVYGAMVLRDTLFEKLSFADYQTVMMPRVHGIWNVQRALATTNGTVDFFINLSSAASFVGNMGQSPYA
ASGTFMAALAQYPETARMRCSTIDLPIVRGVGYLSDDQKREAISKQLGTESVDATDIRGLVTAAIRNEFDSSCEG
HCVAGFEAVKSTPASEQPFWVNDTKLSHLLRLSTLAGGDALAESAQSGAEISPAIVIRQSKTREGAEAIVGAAVL
NKISSILMRPMEDLDPAAPITVYGLDSLVGIEIRNWISRELEANLQILEILTSESVPALAEMILKKSGILTSDLK
VEWGLDMAEGRTSQE*
Coding >Pro_DTO377G3_2|g7828.t1
ATGCGCCTTCAACAGCCCTCCGGGACTGGAACTCCAGTTGCCGAGAGCGCGAATGCATTTTTGCACGAAGCACCT
AGTGAGATCGCCGATAATGCCACAGGCGATGTGCCCAAGCGAATGGCCATCATCGGCATGTCCTGCCGCCTCCCA
GGCGACGTTTCCACGGCCGAAGAGTTCTGGGACCTGTGTTCTCGAGGACGGAGTGCTTGGTCGCTAATCCCGAAA
AACCGATTCAACGCCGAGTCCTTCTATCACCCTGATCCAGATCGACCAGGTTCCTTCAACCCAGTAGGAGCTCAC
TTCCTGAAAGAAGACGTTGGCCTATTCGATGCGCCATTTTTCAACATTACACTCCAAGAGGCGAGATCAATGGAT
CCGCAACAGCGTATTTTCCTTGAATGTGTGTATGAAGCCCTCGAGAACGCTGGAATTCCGAGTCACGAGATCAGT
GGCCAAAAAGTGGGAGTCTTCGCAGGCGCCTCATACCCAGACTACGAAATCAACAACACCAAAGATATCACGGCT
ATCCCTATGTATGCTGCCACTGGAACAGCCGTGGCATTGCAGGCGAATCGAATTTCGTATTATTTTGACTTGAAC
GGGCCTAGTGTTACGGTCGACACAGCTTGCTCTTCCAGCTTATCTGCTCTGCATCTGGCTTCTCAGAGTATCCGG
AACGGTGAATGTTCCATGGCCATTGTGGGAGGATGTCACCTCAATATAACCCCCGAGACTTTCATCTCAATGACA
CGTTCTAGACTACTTTCCGACACTGGTCGCTCATATGCATTTGATCACCGCGGTACTGGCTTTGGCCGAGGTGAA
GGTGCTGGATGTATTATATTGAAGTCTCTTGAGGATGCGGAGGCTGCTGGAGACGCTATCCGATCTGTAATTATC
AACAGTGGTCTCAACCAGGATGGACGGACCAGAGGTATTGCAATGCCAAATGGCAAGGCACAGGAAGAACTGATT
CGTCAAGTCTATAAAGAGGCACGCATTGACCCGTCCTTGGTAGGATTTGTGGAGGCTCACGGTACGGGAACCAAA
GTTGGTGATCCCCTCGAAGCCACTGCATTGAATGCCGTTTTTGGCAAAGGACGCACTCCGCGTCAACCGTTGCTT
GTTGGGTCTGTAAAATCGAACATTGGTCATACAGAAGGAACCAGCGGCGTTGTTTCTGTGATCAAAACTACCTTG
GCACTTGAGCGAGGCTTCGTACCCCCAAACTGCAATTTTGAGAAGGCAAATGATGAGATACCGATGGAAGACTGG
AATATGAAGGTTCCCAAGAAGCTCATGCCTTGGCCCCGTGGCAAACCATACGCAAGTGTGAACAACTTCGGCTTC
GGCGGGACCAATGCCCATGTTATCCTACAGCGTGGTCCCCGGCACGAAGGTGACCTTGCAGCGAACAACGATCCT
CTCAGGCGAAGGTTGTATGTTGTCTCTGCGTACGATAAACAGGCTGCTCTTCAGCTTGGGAAATCAATCGGAACA
TACCTCGACCTTTTCCCGGTTGTTTTCAAAGATAGCACTTTGGATAATATGGCCTATACACTGGGACAGCGACGA
ACATTCCTGCCATGGAGGTTGGCATGCTCTGCAATCCTTGGACAGGAGCTGAATGCATCTCTATCTAACGACGCA
GTGCCTGTTCGTTCTTCCAAAGAGCCTACTGTCGGCTTTGTCTTCACTGGACAAGGTGCGCAATGGCACGGTATG
GGCAAAGAACTTCTGGGCACCTACCCGGTCTTCAAGAAGACTATGCAGGATGTTGACGCTTGCTTGAAATCATTC
GGTGCTACGTTCTCAATTATAGATGAATTGCTTTTGACCGACCCGAGCGCGAGCTCTATTTCTGCCGCATACATG
AGCCAGCCGGCTTGTACTGCGGTCCAGCTAGCGTTGGTTGACCTGCTCTCATCCTGGGGTATTCGCCCCAAGGCA
GTGGTCGGCCATTCTAGCGGAGAGATTGCAGCAGCTTACGCGGCTGGCATTCTGAATTTCGAAGAATGTGTTCGT
GTGGCGTACTCTCGTGGTGTCGCGGCAAACTTGGTAGCAAATGACAAGTCTATCAAGGGAGGTATGTTAGCGGTT
GGAGCCAGCGCCTCAGACATCCAGCAAATTTTGGATGCTATGCGAGGGAACCAGGCTGTCATTGCCTGTGTGAAC
AGTGAGTCCAGCGTGACTTTGTCTGGAGACGCGGAGGTCATCGACGATCTGCAGACTGCCTTGGACAAAGAAGGG
ATCTTCACCCGGAGATTGCAGGTTGAGGTTGCTTACCACTCCCATCATATGAAGATTGTCTCGCACGAATATAGA
TGCCTACTCGGTAAGATTGCACCTCGGGACTCTGAGGTTTCATTCCATTCGACTGTCTATGGAAAATTGGTCCCA
GGAAGCACCTTGGGTGCCTCCTACTGGGTGGACAATCTGGTCTCTCGTGTGGAGTTTGTGGAGGGTCTGAAGAGC
CTTATCACCGATGAGCAGGCAAATACGCCAATCACCACATTAGTCGAAATTGGCCCTCACCCTGCGCTGCAGACA
CCTGTCAAAGACATTGCGCAGAAATACGCCCCAAATTCCAACGTCCATTATCTTCATACCTTGAAACGCAAGGTA
GATGACATCGAAGCTGTCCAAAACCTAGCTGGCTCGCTGTTCACACAGGGTCTGAATCTCGACTTCCAAGCTATC
AACTTCCCGAACTTGAAGACAACGACGAGAAAGCCAGCTTTGTTGACAAATCTGCCCAAATATCCGTGGAACCAC
TCGGAAAGATACTGGTTTAGCTCACGGATAGGTGATAACCATTTCCATCCCCAATTCCCTCGGAGTGATATCCTT
GGCTCATTGTGCATGGAGAATGTCGACTTTGAACCTAGGTGGAGGAACATCATTCGTGCAGATGATCACCCTTGG
ATCCGCGAGCACAGAGTCCATGACCGCACTGTGTATCCAATGACCGGATTCTTGGCCATGGCCATGGAGGCTATT
TCACAACATGCACAGCTGCACCATGTCACTCCCGGAAAGATCGATATCCGCGATATCTTCATTAACCGTGTCCTG
ACTATCCCGGATAACTCATCGGTGGAGACAATTCTCACCTTGAAACCATCCCGATCGGAAGCCCCCAGCAAATCA
GTCCTCGGCTGGCACGAGTTCAAGGTTTTCTCATGGACCGAGGGTCGCGGATGGGACCAACACTGCAATGGTTTC
ATCATGGTGCAAGAAGCGAAGGATGTCAATCCTGTCGACGGGTCTCGACAAGAGCTCGAGAAGACAGCACGCTTC
ACTCAACAAGCATTGAATATGCGAAGTTCCTGTAATATTCCTGTGCATATCGATTTCCTCTACGAGAATATCGCC
AACGGTGGTGTGAATTACGGTCCTCTCTTCCAAGGGCTAACCGAAGCCTCTGTGAGCAGGGATGGCCAAGCACTC
GCTACCTTACGCATCCCAGACACGAAGGCAGCAATGCCACATGGGCATGAGACCCCCTGCATTCTGCATCCTGTT
ACACTTGATCTATGTAGTCAAGTCATGTGGCTGCTTCGTGGTTACGGCGAACCCGGGCCGCATACCACCTTTGTG
CCATCGCATGTGAAGCACATCTCCGTTTCATTGTCCCACGAAATAAGTGCTGGTACTGTACTCCAACTCTATGGT
AGTGGGTCAGGAAACGAGTCCGCGAGCAACCCTGAGACAAACCGCATATTCGCCACCGTTCCCAGCAACCCGGCG
AATCTGCTCATTGACATCAATGGTATTACTTTGGTTCCCATATCGAATGATATCAAAGGCTCAACGGACAATTCG
CCGGATCAGATTTGCTACAAGATGCAATATGAGCCCTGCTTTGATTTCCTCTCCGCCGAAGATTATCGACAGCTT
CCTCGCCCCGAGACTGATGTTGCCCAAGGCATTGAGCGAATGCAGCAACTCGAATATGTGGCAGAGTACTACCTT
GCACAGATGGTCAACTCTGTGACAGAAGATGATTTGTCTACCTTCGAGCCCCATCATCGGCAATTCTATCTTTGG
GCCCAGAAAACTTGCCGAAAGGCGGGCACCAAAGATGCCTTATCACTTGACGTCCTTGAACAAAGCCGAACCGTT
GATGGAGCAAGTGAGCTGGCATTCAAAGTGGGAGAGTTGCTTCCAAAAATCCTCAGGGGCGAGGTAGACGCCTTG
AGTGTACTTCTGGAGGATGATGGAATCGGAAGATACTACAGCGATCTTGACGCTCTTCGCGAGGCCTATGCCAAT
GCCTCTGTCTGTGTTGACAAGATGGCACATCAAAACCCTACACTCAACATCATTGAGATTGGTGCTGGAACAGGC
GGTGCTACCATGCCTATTTTGCAGAGTCTGGGCGGCGAACCAGGGTCAACGCCTCGGTTTGGGCACTACACTTAT
ACCGACATCTCTCCCGGCTTCTTTGAAAAAGCCAAGACAAAGTTCGAGAGCTGGAGACATCTCATGACATACCAG
ACACTAGATGTGTCGGCTGATCCCACTGGCCAAGGCTTCACCAATGGCACATATGATGTTGTAGTTGCTTGCAAT
GTGCTGCATGCTACTACCGACATCAGCCAGACGATGGCAAACATCCGAGGACTTCTGAAGCCTGGTGGCAAGGTT
ATACTCATCGAGGAAACTGTCCCCAGGGCACGCCACTTCCCATTCGCACTCCTCCCTGGATGGTGGCTGGCCAAT
GACAAATTCCGCACAGACGGACCCCTCCTCACCGTCGAAGGATGGAGCAATGTGATGAAGGAGAATGACTTCTCC
GGGGTTGACCTGTGTGTCGAGGAGTACCCTGGAGCATCTTTCCAATCTGGTTGTCTCATGACATCCACTGCTAAT
ATCCCAATAACCGGTCCCGCAAACGCCGGTGATGTTGTGATTCTTGGCGTTGACTCGATCGGCACTTTTTCGTCG
CTCAGTCTCGAATCTGGTCTCAAGGAGATGATTGGGGTTGACCCCATCACGGCTGTCAACTCTGATGAGGTTGAT
GTTACCGGAAAATGGTGTATTTTCCTTGGGGGAATGGATCGCTCGATCCTATCGCATCTCACCCAAGACAAATTC
AACGCATTGCAGCGTCTTCTGAGTCGGGCTCGGGGTCTACTGTGGGTTGTTCGTCACAGCAAATCCGATTTGGAA
TCGCTTGGTGCGAACATGGCAATTGGATTAGCTCGCACTGTGAGATCAGAGACTGGGCTCCAATTCGCCACGCTT
GACCTGGGAGAGCGGGAGAACATGCCCGACGCTGAGGCAGTGAAGCATATGCTCAAGGTATTTAACGGAGTCTTT
TGTCAGAAATCGCAGCTGGCCCAGAATGACTGGGAGTTTGTTGTCCGAAATGGCAATGTTTGTGTGCCCCGCTTG
GTTGACAATAACACATTGAACCTCAGTGTCCAGCAAGAGACACCAAATGCCCCTCCCCAGATGCAGCCTTTCAAA
CAAGATCGGGCTTTGCGACTTGCTGCCGGAGACGGGAGGGGTCTTGATGAGCTTTATTTCACAGATGATGTTTCC
CGCAACGGAGCACTGCCGGAAGACCACATTGAGATCCAGGTTCACAGCACCGGTCTCAACTTTCGAGATGTCTTG
ATGGCCATGGGCCAGCTTCAAGGTGAAAGACTCGGACAGGAATGTAGTGGAGTCGTGACTCAAGTGGGAGCCGCG
GTGTCCGACTTCAAGATCGGAGATCGAGTCTGTGCAATGTCACCAGGTTCATTGTCAACTTTCACTCGCTGTCCG
GCCTCTGGATCCTTGCTTATTCCTGACGACATGTCATTCGAGACATCAGCTTCGATTCCAGCTGTGTTTTGTACT
GCCTTCTATTCTCTCATTGACTTGGGGAGACTGAGCAAAGATGAGAGCGTCCTGATCCACGCCGCTGCAGGAGGA
GTTGGCCAAGCGGCAATAATCATTGCTCAAAGCATTGGAGCTAATATCTTCGCAACCGTTGGCAGCCTCGAAAAG
AAAAACTTCCTTATGGAAACTTACCAGCTGAAAGAGGATCATATCTTCTTCAGTCGTGACATGTCATTTGTGCAG
GGTATTCAGCACGCCACTGGTGGTCAGGGTGTGGATGTTGCCCTCAACTCGCTTAGCGGTGATGCTTTGCAAGCA
ACATTCGAGTGTGTCGCGCCATTTGGTCGTTTCATTGAACTGGGCAAGCGGGACATCACGACAAACTCTCGGTTG
GAGATGTCTCACTTTAACAAGAACATCTCCTTCGCATCTGTCGATTTGGGAATGGTCAGAGAGAAGCGTCCGCAA
TTGACGAAGCGGCTGCTTCGTGATGCGTTTAAGCTGTTTGTTGACACTAACGCCCAATCAAAGTGGTCTGTCACC
ACTCTTCCTATCTCAGACGTCGAGATTGGATTCCGTGCGCTGCAGGGTGGACAGGTGATCGGCAAGATAGTCGTC
CAGGTCACGGATGATTCCATGGTTAAGGTCTATCCCGCCAGAAGAGACGAAAACCTCCTCCGCGCGGACGCTTCA
TATATCATCGTTGGTGGGACCGGTGGGATTGGCCTCAACATTGCCAGCTGGATGCCAGAGAGGGGAGCCAAGAAT
CTTATCCTGGTTTCTCGAAGTGGTATTAAGACTGAAAAGGCCGAGCAAGCTGTTCAGAATCTTATCCGCCAGGGT
GTTAATGTGGAAGTCTGTCGCTGCGATGTGGCGGACCAACAGAGCGTGGAGCAAGATCTTGTTCCGCTCCTCGCT
CGCATGCCTCCCGCTCGTGGTGTTGTATACGGCGCCATGGTTCTCCGGGATACGCTCTTCGAAAAGCTCAGTTTT
GCGGACTACCAAACGGTGATGATGCCCAGAGTCCACGGAATCTGGAACGTTCAACGGGCATTGGCAACAACTAAT
GGTACCGTGGATTTCTTCATCAACCTATCGTCCGCCGCTAGTTTTGTAGGCAATATGGGTCAATCACCATACGCA
GCCAGTGGAACCTTCATGGCTGCGCTCGCCCAGTACCCTGAGACAGCCAGGATGCGCTGTTCAACAATCGATTTG
CCCATTGTGCGTGGAGTCGGATATCTCTCCGACGATCAGAAGCGCGAGGCAATCTCCAAACAATTGGGCACAGAG
TCCGTTGATGCAACTGATATCCGTGGTCTTGTAACGGCAGCAATCCGCAACGAGTTCGACAGTTCATGCGAGGGT
CACTGCGTGGCTGGGTTTGAAGCAGTCAAATCCACACCTGCCAGTGAACAGCCCTTCTGGGTAAACGATACCAAG
CTGTCGCACCTGTTGCGCCTCTCTACTCTCGCTGGCGGGGATGCATTGGCCGAGTCTGCACAGAGCGGTGCCGAG
ATTTCACCAGCAATTGTTATCCGGCAATCGAAGACCCGCGAAGGAGCCGAGGCCATTGTTGGGGCTGCCGTGCTC
AACAAGATCTCTAGCATTCTTATGCGTCCGATGGAAGACCTTGACCCTGCTGCGCCTATCACGGTTTACGGCTTG
GACTCGCTGGTCGGTATCGAGATCCGAAACTGGATCTCCCGCGAGTTGGAAGCTAATTTGCAGATCCTTGAGATT
TTGACCAGTGAATCTGTCCCGGCTCTTGCCGAGATGATTCTCAAGAAATCGGGTATACTTACTTCAGACCTCAAG
GTTGAGTGGGGTCTTGACATGGCTGAAGGCAGAACCAGCCAAGAATGA
Transcript >Pro_DTO377G3_2|g7828.t1
ATGCGCCTTCAACAGCCCTCCGGGACTGGAACTCCAGTTGCCGAGAGCGCGAATGCATTTTTGCACGAAGCACCT
AGTGAGATCGCCGATAATGCCACAGGCGATGTGCCCAAGCGAATGGCCATCATCGGCATGTCCTGCCGCCTCCCA
GGCGACGTTTCCACGGCCGAAGAGTTCTGGGACCTGTGTTCTCGAGGACGGAGTGCTTGGTCGCTAATCCCGAAA
AACCGATTCAACGCCGAGTCCTTCTATCACCCTGATCCAGATCGACCAGGTTCCTTCAACCCAGTAGGAGCTCAC
TTCCTGAAAGAAGACGTTGGCCTATTCGATGCGCCATTTTTCAACATTACACTCCAAGAGGCGAGATCAATGGAT
CCGCAACAGCGTATTTTCCTTGAATGTGTGTATGAAGCCCTCGAGAACGCTGGAATTCCGAGTCACGAGATCAGT
GGCCAAAAAGTGGGAGTCTTCGCAGGCGCCTCATACCCAGACTACGAAATCAACAACACCAAAGATATCACGGCT
ATCCCTATGTATGCTGCCACTGGAACAGCCGTGGCATTGCAGGCGAATCGAATTTCGTATTATTTTGACTTGAAC
GGGCCTAGTGTTACGGTCGACACAGCTTGCTCTTCCAGCTTATCTGCTCTGCATCTGGCTTCTCAGAGTATCCGG
AACGGTGAATGTTCCATGGCCATTGTGGGAGGATGTCACCTCAATATAACCCCCGAGACTTTCATCTCAATGACA
CGTTCTAGACTACTTTCCGACACTGGTCGCTCATATGCATTTGATCACCGCGGTACTGGCTTTGGCCGAGGTGAA
GGTGCTGGATGTATTATATTGAAGTCTCTTGAGGATGCGGAGGCTGCTGGAGACGCTATCCGATCTGTAATTATC
AACAGTGGTCTCAACCAGGATGGACGGACCAGAGGTATTGCAATGCCAAATGGCAAGGCACAGGAAGAACTGATT
CGTCAAGTCTATAAAGAGGCACGCATTGACCCGTCCTTGGTAGGATTTGTGGAGGCTCACGGTACGGGAACCAAA
GTTGGTGATCCCCTCGAAGCCACTGCATTGAATGCCGTTTTTGGCAAAGGACGCACTCCGCGTCAACCGTTGCTT
GTTGGGTCTGTAAAATCGAACATTGGTCATACAGAAGGAACCAGCGGCGTTGTTTCTGTGATCAAAACTACCTTG
GCACTTGAGCGAGGCTTCGTACCCCCAAACTGCAATTTTGAGAAGGCAAATGATGAGATACCGATGGAAGACTGG
AATATGAAGGTTCCCAAGAAGCTCATGCCTTGGCCCCGTGGCAAACCATACGCAAGTGTGAACAACTTCGGCTTC
GGCGGGACCAATGCCCATGTTATCCTACAGCGTGGTCCCCGGCACGAAGGTGACCTTGCAGCGAACAACGATCCT
CTCAGGCGAAGGTTGTATGTTGTCTCTGCGTACGATAAACAGGCTGCTCTTCAGCTTGGGAAATCAATCGGAACA
TACCTCGACCTTTTCCCGGTTGTTTTCAAAGATAGCACTTTGGATAATATGGCCTATACACTGGGACAGCGACGA
ACATTCCTGCCATGGAGGTTGGCATGCTCTGCAATCCTTGGACAGGAGCTGAATGCATCTCTATCTAACGACGCA
GTGCCTGTTCGTTCTTCCAAAGAGCCTACTGTCGGCTTTGTCTTCACTGGACAAGGTGCGCAATGGCACGGTATG
GGCAAAGAACTTCTGGGCACCTACCCGGTCTTCAAGAAGACTATGCAGGATGTTGACGCTTGCTTGAAATCATTC
GGTGCTACGTTCTCAATTATAGATGAATTGCTTTTGACCGACCCGAGCGCGAGCTCTATTTCTGCCGCATACATG
AGCCAGCCGGCTTGTACTGCGGTCCAGCTAGCGTTGGTTGACCTGCTCTCATCCTGGGGTATTCGCCCCAAGGCA
GTGGTCGGCCATTCTAGCGGAGAGATTGCAGCAGCTTACGCGGCTGGCATTCTGAATTTCGAAGAATGTGTTCGT
GTGGCGTACTCTCGTGGTGTCGCGGCAAACTTGGTAGCAAATGACAAGTCTATCAAGGGAGGTATGTTAGCGGTT
GGAGCCAGCGCCTCAGACATCCAGCAAATTTTGGATGCTATGCGAGGGAACCAGGCTGTCATTGCCTGTGTGAAC
AGTGAGTCCAGCGTGACTTTGTCTGGAGACGCGGAGGTCATCGACGATCTGCAGACTGCCTTGGACAAAGAAGGG
ATCTTCACCCGGAGATTGCAGGTTGAGGTTGCTTACCACTCCCATCATATGAAGATTGTCTCGCACGAATATAGA
TGCCTACTCGGTAAGATTGCACCTCGGGACTCTGAGGTTTCATTCCATTCGACTGTCTATGGAAAATTGGTCCCA
GGAAGCACCTTGGGTGCCTCCTACTGGGTGGACAATCTGGTCTCTCGTGTGGAGTTTGTGGAGGGTCTGAAGAGC
CTTATCACCGATGAGCAGGCAAATACGCCAATCACCACATTAGTCGAAATTGGCCCTCACCCTGCGCTGCAGACA
CCTGTCAAAGACATTGCGCAGAAATACGCCCCAAATTCCAACGTCCATTATCTTCATACCTTGAAACGCAAGGTA
GATGACATCGAAGCTGTCCAAAACCTAGCTGGCTCGCTGTTCACACAGGGTCTGAATCTCGACTTCCAAGCTATC
AACTTCCCGAACTTGAAGACAACGACGAGAAAGCCAGCTTTGTTGACAAATCTGCCCAAATATCCGTGGAACCAC
TCGGAAAGATACTGGTTTAGCTCACGGATAGGTGATAACCATTTCCATCCCCAATTCCCTCGGAGTGATATCCTT
GGCTCATTGTGCATGGAGAATGTCGACTTTGAACCTAGGTGGAGGAACATCATTCGTGCAGATGATCACCCTTGG
ATCCGCGAGCACAGAGTCCATGACCGCACTGTGTATCCAATGACCGGATTCTTGGCCATGGCCATGGAGGCTATT
TCACAACATGCACAGCTGCACCATGTCACTCCCGGAAAGATCGATATCCGCGATATCTTCATTAACCGTGTCCTG
ACTATCCCGGATAACTCATCGGTGGAGACAATTCTCACCTTGAAACCATCCCGATCGGAAGCCCCCAGCAAATCA
GTCCTCGGCTGGCACGAGTTCAAGGTTTTCTCATGGACCGAGGGTCGCGGATGGGACCAACACTGCAATGGTTTC
ATCATGGTGCAAGAAGCGAAGGATGTCAATCCTGTCGACGGGTCTCGACAAGAGCTCGAGAAGACAGCACGCTTC
ACTCAACAAGCATTGAATATGCGAAGTTCCTGTAATATTCCTGTGCATATCGATTTCCTCTACGAGAATATCGCC
AACGGTGGTGTGAATTACGGTCCTCTCTTCCAAGGGCTAACCGAAGCCTCTGTGAGCAGGGATGGCCAAGCACTC
GCTACCTTACGCATCCCAGACACGAAGGCAGCAATGCCACATGGGCATGAGACCCCCTGCATTCTGCATCCTGTT
ACACTTGATCTATGTAGTCAAGTCATGTGGCTGCTTCGTGGTTACGGCGAACCCGGGCCGCATACCACCTTTGTG
CCATCGCATGTGAAGCACATCTCCGTTTCATTGTCCCACGAAATAAGTGCTGGTACTGTACTCCAACTCTATGGT
AGTGGGTCAGGAAACGAGTCCGCGAGCAACCCTGAGACAAACCGCATATTCGCCACCGTTCCCAGCAACCCGGCG
AATCTGCTCATTGACATCAATGGTATTACTTTGGTTCCCATATCGAATGATATCAAAGGCTCAACGGACAATTCG
CCGGATCAGATTTGCTACAAGATGCAATATGAGCCCTGCTTTGATTTCCTCTCCGCCGAAGATTATCGACAGCTT
CCTCGCCCCGAGACTGATGTTGCCCAAGGCATTGAGCGAATGCAGCAACTCGAATATGTGGCAGAGTACTACCTT
GCACAGATGGTCAACTCTGTGACAGAAGATGATTTGTCTACCTTCGAGCCCCATCATCGGCAATTCTATCTTTGG
GCCCAGAAAACTTGCCGAAAGGCGGGCACCAAAGATGCCTTATCACTTGACGTCCTTGAACAAAGCCGAACCGTT
GATGGAGCAAGTGAGCTGGCATTCAAAGTGGGAGAGTTGCTTCCAAAAATCCTCAGGGGCGAGGTAGACGCCTTG
AGTGTACTTCTGGAGGATGATGGAATCGGAAGATACTACAGCGATCTTGACGCTCTTCGCGAGGCCTATGCCAAT
GCCTCTGTCTGTGTTGACAAGATGGCACATCAAAACCCTACACTCAACATCATTGAGATTGGTGCTGGAACAGGC
GGTGCTACCATGCCTATTTTGCAGAGTCTGGGCGGCGAACCAGGGTCAACGCCTCGGTTTGGGCACTACACTTAT
ACCGACATCTCTCCCGGCTTCTTTGAAAAAGCCAAGACAAAGTTCGAGAGCTGGAGACATCTCATGACATACCAG
ACACTAGATGTGTCGGCTGATCCCACTGGCCAAGGCTTCACCAATGGCACATATGATGTTGTAGTTGCTTGCAAT
GTGCTGCATGCTACTACCGACATCAGCCAGACGATGGCAAACATCCGAGGACTTCTGAAGCCTGGTGGCAAGGTT
ATACTCATCGAGGAAACTGTCCCCAGGGCACGCCACTTCCCATTCGCACTCCTCCCTGGATGGTGGCTGGCCAAT
GACAAATTCCGCACAGACGGACCCCTCCTCACCGTCGAAGGATGGAGCAATGTGATGAAGGAGAATGACTTCTCC
GGGGTTGACCTGTGTGTCGAGGAGTACCCTGGAGCATCTTTCCAATCTGGTTGTCTCATGACATCCACTGCTAAT
ATCCCAATAACCGGTCCCGCAAACGCCGGTGATGTTGTGATTCTTGGCGTTGACTCGATCGGCACTTTTTCGTCG
CTCAGTCTCGAATCTGGTCTCAAGGAGATGATTGGGGTTGACCCCATCACGGCTGTCAACTCTGATGAGGTTGAT
GTTACCGGAAAATGGTGTATTTTCCTTGGGGGAATGGATCGCTCGATCCTATCGCATCTCACCCAAGACAAATTC
AACGCATTGCAGCGTCTTCTGAGTCGGGCTCGGGGTCTACTGTGGGTTGTTCGTCACAGCAAATCCGATTTGGAA
TCGCTTGGTGCGAACATGGCAATTGGATTAGCTCGCACTGTGAGATCAGAGACTGGGCTCCAATTCGCCACGCTT
GACCTGGGAGAGCGGGAGAACATGCCCGACGCTGAGGCAGTGAAGCATATGCTCAAGGTATTTAACGGAGTCTTT
TGTCAGAAATCGCAGCTGGCCCAGAATGACTGGGAGTTTGTTGTCCGAAATGGCAATGTTTGTGTGCCCCGCTTG
GTTGACAATAACACATTGAACCTCAGTGTCCAGCAAGAGACACCAAATGCCCCTCCCCAGATGCAGCCTTTCAAA
CAAGATCGGGCTTTGCGACTTGCTGCCGGAGACGGGAGGGGTCTTGATGAGCTTTATTTCACAGATGATGTTTCC
CGCAACGGAGCACTGCCGGAAGACCACATTGAGATCCAGGTTCACAGCACCGGTCTCAACTTTCGAGATGTCTTG
ATGGCCATGGGCCAGCTTCAAGGTGAAAGACTCGGACAGGAATGTAGTGGAGTCGTGACTCAAGTGGGAGCCGCG
GTGTCCGACTTCAAGATCGGAGATCGAGTCTGTGCAATGTCACCAGGTTCATTGTCAACTTTCACTCGCTGTCCG
GCCTCTGGATCCTTGCTTATTCCTGACGACATGTCATTCGAGACATCAGCTTCGATTCCAGCTGTGTTTTGTACT
GCCTTCTATTCTCTCATTGACTTGGGGAGACTGAGCAAAGATGAGAGCGTCCTGATCCACGCCGCTGCAGGAGGA
GTTGGCCAAGCGGCAATAATCATTGCTCAAAGCATTGGAGCTAATATCTTCGCAACCGTTGGCAGCCTCGAAAAG
AAAAACTTCCTTATGGAAACTTACCAGCTGAAAGAGGATCATATCTTCTTCAGTCGTGACATGTCATTTGTGCAG
GGTATTCAGCACGCCACTGGTGGTCAGGGTGTGGATGTTGCCCTCAACTCGCTTAGCGGTGATGCTTTGCAAGCA
ACATTCGAGTGTGTCGCGCCATTTGGTCGTTTCATTGAACTGGGCAAGCGGGACATCACGACAAACTCTCGGTTG
GAGATGTCTCACTTTAACAAGAACATCTCCTTCGCATCTGTCGATTTGGGAATGGTCAGAGAGAAGCGTCCGCAA
TTGACGAAGCGGCTGCTTCGTGATGCGTTTAAGCTGTTTGTTGACACTAACGCCCAATCAAAGTGGTCTGTCACC
ACTCTTCCTATCTCAGACGTCGAGATTGGATTCCGTGCGCTGCAGGGTGGACAGGTGATCGGCAAGATAGTCGTC
CAGGTCACGGATGATTCCATGGTTAAGGTCTATCCCGCCAGAAGAGACGAAAACCTCCTCCGCGCGGACGCTTCA
TATATCATCGTTGGTGGGACCGGTGGGATTGGCCTCAACATTGCCAGCTGGATGCCAGAGAGGGGAGCCAAGAAT
CTTATCCTGGTTTCTCGAAGTGGTATTAAGACTGAAAAGGCCGAGCAAGCTGTTCAGAATCTTATCCGCCAGGGT
GTTAATGTGGAAGTCTGTCGCTGCGATGTGGCGGACCAACAGAGCGTGGAGCAAGATCTTGTTCCGCTCCTCGCT
CGCATGCCTCCCGCTCGTGGTGTTGTATACGGCGCCATGGTTCTCCGGGATACGCTCTTCGAAAAGCTCAGTTTT
GCGGACTACCAAACGGTGATGATGCCCAGAGTCCACGGAATCTGGAACGTTCAACGGGCATTGGCAACAACTAAT
GGTACCGTGGATTTCTTCATCAACCTATCGTCCGCCGCTAGTTTTGTAGGCAATATGGGTCAATCACCATACGCA
GCCAGTGGAACCTTCATGGCTGCGCTCGCCCAGTACCCTGAGACAGCCAGGATGCGCTGTTCAACAATCGATTTG
CCCATTGTGCGTGGAGTCGGATATCTCTCCGACGATCAGAAGCGCGAGGCAATCTCCAAACAATTGGGCACAGAG
TCCGTTGATGCAACTGATATCCGTGGTCTTGTAACGGCAGCAATCCGCAACGAGTTCGACAGTTCATGCGAGGGT
CACTGCGTGGCTGGGTTTGAAGCAGTCAAATCCACACCTGCCAGTGAACAGCCCTTCTGGGTAAACGATACCAAG
CTGTCGCACCTGTTGCGCCTCTCTACTCTCGCTGGCGGGGATGCATTGGCCGAGTCTGCACAGAGCGGTGCCGAG
ATTTCACCAGCAATTGTTATCCGGCAATCGAAGACCCGCGAAGGAGCCGAGGCCATTGTTGGGGCTGCCGTGCTC
AACAAGATCTCTAGCATTCTTATGCGTCCGATGGAAGACCTTGACCCTGCTGCGCCTATCACGGTTTACGGCTTG
GACTCGCTGGTCGGTATCGAGATCCGAAACTGGATCTCCCGCGAGTTGGAAGCTAATTTGCAGATCCTTGAGATT
TTGACCAGTGAATCTGTCCCGGCTCTTGCCGAGATGATTCTCAAGAAATCGGGTATACTTACTTCAGACCTCAAG
GTTGAGTGGGGTCTTGACATGGCTGAAGGCAGAACCAGCCAAGAATGA
Gene >Pro_DTO377G3_2|g7828.t1
ATGCGCCTTCAACAGCCCTCCGGGACTGGAACTCCAGTTGCCGAGAGCGCGAATGCATTTTTGCACGAAGCACCT
AGTGAGATCGCCGATAATGCCACAGGCGATGTGCCCAAGCGAATGGCCATCATCGGCATGTCCTGCCGCCTCCCA
GGCGACGTTTCCACGGCCGAAGAGTTCTGGGACCTGTGTTCTCGAGGACGGAGTGCTTGGTCGCTAATCCCGAAA
AACCGATTCAACGCCGAGTCCTTCTATCACCCTGATCCAGATCGACCAGGTTCCTTCAACCCAGTAGGAGCTCAC
TTCCTGAAAGAAGACGTTGGCCTATTCGATGCGCCATTTTTCAACATTACACTCCAAGAGGCGAGATCAATGGAT
CCGCAACAGCGTATTTTCCTTGAATGTGTGTATGAAGCCCTCGAGAACGCTGGAATTCCGAGTCACGAGATCAGT
GGCCAAAAAGTGGGAGTCTTCGCAGGCGCCTCATACCCAGACTACGAAATCAACAACACCAAAGATATCACGGCT
ATCCCTATGTATGCTGCCACTGGAACAGCCGTGGCATTGCAGGCGAATCGAATTTCGTATTATTTTGACTTGAAC
GGGCCTAGTGTTACGGTCGACACAGCTTGCTCTTCCAGCTTATCTGCTCTGCATCTGGCTTCTCAGAGTATCCGG
AACGGTGAATGTTCCATGGCCATTGTGGGAGGATGTCACCTCAATATAACCCCCGAGACTTTCATCTCAATGACA
CGTTCTAGGTAAGTGTCACTGGCAGTCTCCTTGACCCACAAAAGCTGATTAATCCCCAAGACTACTTTCCGACAC
TGGTCGCTCATATGCATTTGATCACCGCGGTACTGGCTTTGGCCGAGGTGAAGGTGCTGGATGTATTATATTGAA
GTCTCTTGAGGATGCGGAGGCTGCTGGAGACGCTATCCGATCTGTAATTATCAACAGTGGTCTCAACCAGGATGG
ACGGACCAGAGGTATTGCAATGCCAAATGGCAAGGCACAGGAAGAACTGATTCGTCAAGTCTATAAAGAGGCACG
CATTGACCCGTCCTTGGTAGGATTTGTGGAGGCTCACGGTACGGGAACCAAAGTTGGTGATCCCCTCGAAGCCAC
TGCATTGAATGCCGTTTTTGGCAAAGGACGCACTCCGCGTCAACCGTTGCTTGTTGGGTCTGTAAAATCGAACAT
TGGTCATACAGAAGGAACCAGCGGCGTTGTTTCTGTGATCAAAACTACCTTGGCACTTGAGCGAGGCTTCGTACC
CCCAAACTGCAATTTTGAGAAGGCAAATGATGAGATACCGATGGAAGACTGGAATATGAAGGTAAGATCAAGCAC
CGACTTGAGGTATCAATGGACCGAGCTAAACATCCAACCAGGTTCCCAAGAAGCTCATGCCTTGGCCCCGTGGCA
AACCATACGCAAGTGTGAACAACTTCGGCTTCGGCGGGACCAATGCCCATGTTATCCTACAGCGTGGTCCCCGGC
ACGAAGGTGACCTTGCAGCGAACAACGATCCTCTCAGGCGAAGGTTGTATGTTGTCTCTGCGTACGATAAACAGG
CTGCTCTTCAGCTTGGGAAATCAATCGGAACATACCTCGACCTTTTCCCGGTTGTTTTCAAAGATAGCACTTTGG
ATAATATGGCCTATACACTGGGACAGCGACGAACATTCCTGCCATGGAGGTTGGCATGCTCTGCAATCCTTGGAC
AGGAGCTGAATGCATCTCTATCTAACGACGCAGTGCCTGTTCGTTCTTCCAAAGAGCCTACTGTCGGCTTTGTCT
TCACTGGACAAGGTGCGCAATGGCACGGTATGGGCAAAGAACTTCTGGGCACCTACCCGGTCTTCAAGAAGACTA
TGCAGGATGTTGACGCTTGCTTGAAATCATTCGGTGCTACGTTCTCAATTATAGGTATGTCTCCAACCCAATTGT
GACACTGCCCAAAGCGATATACTCAGACACTAACCTCGCAATGCAAAGATGAATTGCTTTTGACCGACCCGAGCG
CGAGCTCTATTTCTGCCGCATACATGAGCCAGCCGGCTTGTACTGCGGTCCAGCTAGCGTTGGTTGACCTGCTCT
CATCCTGGGGTATTCGCCCCAAGGCAGTGGTCGGCCATTCTAGCGGAGAGATTGCAGCAGCTTACGCGGCTGGCA
TTCTGAATTTCGAAGAATGTGTTCGTGTGGCGTACTCTCGTGGTGTCGCGGCAAACTTGGTAGCAAATGACAAGT
CTATCAAGGGAGGTATGTTAGCGGTTGGAGCCAGCGCCTCAGACATCCAGCAAATTTTGGATGCTATGCGAGGGA
ACCAGGCTGTCATTGCCTGTGTGAACAGTGAGTCCAGCGTGACTTTGTCTGGAGACGCGGAGGTCATCGACGATC
TGCAGACTGCCTTGGACAAAGAAGGGATCTTCACCCGGAGATTGCAGGTTGAGGTTGCTTACCACTCCCATCATA
TGAAGATTGTCTCGCACGAATATAGATGCCTACTCGGTAAGATTGCACCTCGGGACTCTGAGGTTTCATTCCATT
CGACTGTCTATGGAAAATTGGTCCCAGGAAGCACCTTGGGTGCCTCCTACTGGGTGGACAATCTGGTCTCTCGTG
TGGAGTTTGTGGAGGGTCTGAAGAGCCTTATCACCGATGAGCAGGCAAATACGCCAATCACCACATTAGTCGAAA
TTGGCCCTCACCCTGCGCTGCAGACACCTGTCAAAGACATTGCGCAGAAATACGCCCCAAATTCCAACGTCCATT
ATCTTCATACCTTGAAACGCAAGGTAGATGACATCGAAGCTGTCCAAAACCTAGCTGGCTCGCTGTTCACACAGG
GTCTGAATCTCGACTTCCAAGCTATCAACTTCCCGAACTTGAAGACAACGACGAGAAAGCCAGCTTTGTTGACAA
ATCTGCCCAAATATCCGTGGAACCACTCGGAAAGATACTGGTTTAGCTCACGGATAGGTGATAACCATTTCCATC
CCCAATTCCCTCGGAGTGATATCCTTGGCTCATTGTGCATGGAGAATGTCGACTTTGAACCTAGGTGGAGGAACA
TCATTCGTGCAGATGATCACCCTTGGATCCGCGAGCACAGAGTCCATGACCGCACTGTGTATCCAATGACCGGAT
TCTTGGCCATGGCCATGGAGGCTATTTCACAACATGCACAGCTGCACCATGTCACTCCCGGAAAGATCGATATCC
GCGATATCTTCATTAACCGTGTCCTGACTATCCCGGATAACTCATCGGTGGAGACAATTCTCACCTTGAAACCAT
CCCGATCGGAAGCCCCCAGCAAATCAGTCCTCGGCTGGCACGAGTTCAAGGTTTTCTCATGGACCGAGGGTCGCG
GATGGGACCAACACTGCAATGGTTTCATCATGGTGCAAGAAGCGAAGGATGTCAATCCTGTCGACGGGTCTCGAC
AAGAGCTCGAGAAGACAGCACGCTTCACTCAACAAGCATTGAATATGCGAAGTTCCTGTAATATTCCTGTGCATA
TCGATTTCCTCTACGAGAATATCGCCAACGGTGGTGTGAATTACGGTCCTCTCTTCCAAGGGCTAACCGAAGCCT
CTGTGAGCAGGGATGGCCAAGCACTCGCTACCTTACGCATCCCAGACACGAAGGCAGCAATGCCACATGGGCATG
AGACCCCCTGCATTCTGCATCCTGTTACACTTGATCTATGTAGTCAAGTCATGTGGCTGCTTCGTGGTTACGGCG
AACCCGGGCCGCATACCACCTTTGTGCCATCGCATGTGAAGCACATCTCCGTTTCATTGTCCCACGAAATAAGTG
CTGGTACTGTACTCCAACTCTATGGTAGTGGGTCAGGAAACGAGTCCGCGAGCAACCCTGAGACAAACCGCATAT
TCGCCACCGTTCCCAGCAACCCGGCGAATCTGCTCATTGACATCAATGGTATTACTTTGGTTCCCATATCGAATG
ATATCAAAGGCTCAACGGACAATTCGCCGGATCAGATTTGCTACAAGATGCAATATGAGCCCTGCTTTGATTTCC
TCTCCGCCGAAGATTATCGACAGCTTCCTCGCCCCGAGACTGATGTTGCCCAAGGCATTGAGCGAATGCAGCAAC
TCGAATATGTGGCAGAGTACTACCTTGCACAGATGGTCAACTCTGTGACAGAAGATGATTTGTCTACCTTCGAGC
CCCATCATCGGCAATTCTATCTTTGGGCCCAGAAAACTTGCCGAAAGGCGGGCACCAAAGATGCCTTATCACTTG
ACGTCCTTGAACAAAGCCGAACCGTTGATGGAGCAAGTGAGCTGGCATTCAAAGTGGGAGAGTTGCTTCCAAAAA
TCCTCAGGGGCGAGGTAGACGCCTTGAGTGTACTTCTGGAGGATGATGGAATCGGAAGATACTACAGCGATCTTG
ACGCTCTTCGCGAGGCCTATGCCAATGCCTCTGTCTGTGTTGACAAGATGGCACATCAAAACCCTACACTCAACA
TCATTGAGATTGGTGCTGGAACAGGCGGTGCTACCATGCCTATTTTGCAGAGTCTGGGCGGCGAACCAGGGTCAA
CGCCTCGGTTTGGGCACTACACTTATACCGACATCTCTCCCGGCTTCTTTGAAAAAGCCAAGACAAAGTTCGAGA
GCTGGAGACATCTCATGACATACCAGACACTAGATGTGTCGGCTGATCCCACTGGCCAAGGCTTCACCAATGGCA
CATATGATGTTGTAGTTGCTTGCAATGTGCTGCATGCTACTACCGACATCAGCCAGACGATGGCAAACATCCGAG
GACTTCTGAAGCCTGGTGGCAAGGTTATACTCATCGAGGAAACTGTCCCCAGGGCACGCCACTTCCCATTCGCAC
TCCTCCCTGGATGGTGGCTGGCCAATGACAAATTCCGCACAGACGGACCCCTCCTCACCGTCGAAGGATGGAGCA
ATGTGATGAAGGAGAATGACTTCTCCGGGGTTGACCTGTGTGTCGAGGAGTACCCTGGAGCATCTTTCCAATCTG
GTTGTCTCATGACATCCACTGCTAATATCCCAATAACCGGTCCCGCAAACGCCGGTGATGTTGTGATTCTTGGCG
TTGACTCGATCGGCACTTTTTCGTCGCTCAGTCTCGAATCTGGTCTCAAGGAGATGATTGGGGTTGACCCCATCA
CGGCTGTCAACTCTGATGAGGTTGATGTTACCGGAAAATGGTGTATTTTCCTTGGGGGAATGGATCGCTCGATCC
TATCGCATCTCACCCAAGACAAATTCAACGCATTGCAGCGTCTTCTGAGTCGGGCTCGGGGTCTACTGTGGGTTG
TTCGTCACAGCAAATCCGATTTGGAATCGCTTGGTGCGAACATGGCAATTGGATTAGCTCGCACTGTGAGATCAG
AGACTGGGCTCCAATTCGCCACGCTTGACCTGGGAGAGCGGGAGAACATGCCCGACGCTGAGGCAGTGAAGCATA
TGCTCAAGGTATTTAACGGAGTCTTTTGTCAGAAATCGCAGCTGGCCCAGAATGACTGGGAGTTTGTTGTCCGAA
ATGGCAATGTTTGTGTGCCCCGCTTGGTTGACAATAACACATTGAACCTCAGTGTCCAGCAAGAGACACCAAATG
CCCCTCCCCAGATGCAGCCTTTCAAACAAGATCGGGCTTTGCGACTTGCTGCCGGAGACGGGAGGGGTCTTGATG
AGCTTTATTTCACAGATGATGTTTCCCGCAACGGAGCACTGCCGGAAGACCACATTGAGATCCAGGTTCACAGCA
CCGGTCTCAACTTTCGAGATGTCTTGATGGCCATGGGCCAGCTTCAAGGTGAAAGACTCGGACAGGAATGTAGTG
GAGTCGTGACTCAAGTGGGAGCCGCGGTGTCCGACTTCAAGATCGGAGATCGAGTCTGTGCAATGTCACCAGGTT
CATTGTCAACTTTCACTCGCTGTCCGGCCTCTGGATCCTTGCTTATTCCTGACGACATGTCATTCGAGACATCAG
CTTCGATTCCAGCTGTGTTTTGTACTGCCTTCTATTCTCTCATTGACTTGGGGAGACTGAGCAAAGATGAGAGCG
TCCTGATCCACGCCGCTGCAGGAGGAGTTGGCCAAGCGGCAATAATCATTGCTCAAAGCATTGGAGCTAATATCT
TCGCAACCGTTGGCAGCCTCGAAAAGAAAAACTTCCTTATGGAAACTTACCAGCTGAAAGAGGATCATATCTTCT
TCAGTCGTGACATGTCATTTGTGCAGGGTATTCAGCACGCCACTGGTGGTCAGGGTGTGGATGTTGCCCTCAACT
CGCTTAGCGGTGATGCTTTGCAAGCAACATTCGAGTGTGTCGCGCCATTTGGTCGTTTCATTGAACTGGGCAAGC
GGGACATCACGACAAACTCTCGGTTGGAGATGTCTCACTTTAACAAGAACATCTCCTTCGCATCTGTCGATTTGG
GAATGGTCAGAGAGAAGCGTCCGCAATTGACGAAGCGGCTGCTTCGTGATGCGTTTAAGCTGTTTGTTGACACTA
ACGCCCAATCAAAGTGGTCTGTCACCACTCTTCCTATCTCAGACGTCGAGATTGGATTCCGTGCGCTGCAGGGTG
GACAGGTGATCGGCAAGATAGTCGTCCAGGTCACGGATGATTCCATGGTTAAGGTATGTTTGCTGATATCTACGA
CAATTGGAGCAAATGATCGCTAACTCACCACACAGGTCTATCCCGCCAGAAGAGACGAAAACCTCCTCCGCGCGG
ACGCTTCATATATCATCGTTGGTGGGACCGGTGGGATTGGCCTCAACATTGCCAGCTGGATGCCAGAGAGGGGAG
CCAAGAATCTTATCCTGGTTTCTCGAAGTGGTATTAAGACTGAAAAGGCCGAGCAAGCTGTTCAGAATCTTATCC
GCCAGGGTGTTAATGTGGAAGTCTGTCGCTGCGATGTGGCGGACCAACAGAGCGTGGAGCAAGATCTTGTTCCGC
TCCTCGCTCGCATGCCTCCCGCTCGTGGTGTTGTATACGGCGCCATGGTTCTCCGGGTAAGTTTATCAGCATCAA
ACAACAGATAAGATCTCGGCTAACTTTCTCGTAAGGATACGCTCTTCGAAAAGCTCAGTTTTGCGGACTACCAAA
CGGTGATGATGCCCAGAGTCCACGGAATCTGGAACGTTCAACGGGCATTGGCAACAACTAATGGTACCGTGGATT
TCTTCATCAACCTATCGTCCGCCGCTAGTTTTGTAGGCAATATGGGTCAATCACCATACGCAGCCAGTGGAACCT
TCATGGCTGCGCTCGCCCAGTACCCTGAGACAGCCAGGATGCGCTGTTCAACAATCGATTTGCCCATTGTGCGTG
GAGTCGGATATCTCTCCGACGATCAGAAGCGCGAGGCAATCTCCAAACAATTGGGCACAGAGTCCGTTGATGCAA
CTGATATCCGTGGTCTTGTAACGGCAGCAATCCGCAACGAGTTCGACAGTTCATGCGAGGGTCACTGCGTGGCTG
GGTTTGAAGCAGTCAAATCCACACCTGCCAGTGAACAGCCCTTCTGGGTAAACGATACCAAGCTGTCGCACCTGT
TGCGCCTCTCTACTCTCGCTGGCGGGGATGCATTGGCCGAGTCTGCACAGAGCGGTGCCGAGATTTCACCAGCAA
TTGTTATCCGGCAATCGAAGACCCGCGAAGGAGCCGAGGCCATTGTTGGGGCTGCCGTGCTCAACAAGATCTCTA
GCATTCTTATGCGTCCGATGGAAGACCTTGACCCTGCTGCGCCTATCACGGTTTACGGCTTGGACTCGCTGGTCG
GTATCGAGATCCGAAACTGGATCTCCCGCGAGTTGGAAGCTAATTTGCAGATCCTTGAGATTTTGACCAGTGAAT
CTGTCCCGGCTCTTGCCGAGATGATTCTCAAGAAATCGGGTATACTTACTTCAGACCTCAAGGTTGAGTGGGGTC
TTGACATGGCTGAAGGCAGAACCAGCCAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail