Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7826.t1
Gene name
Locationscaffold_26:207925..208841
Strand+
Gene length (bp)916
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 4.3E-50 21 198

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 228.27 139.44 317.11
5d_25C Five days - 25 degrees Celsius 177.38 107.07 247.68
7d_25C Seven days - 25 degrees Celsius 170.73 101.70 239.76
10d_25C Ten days - 25 degrees Celsius 169.51 102.12 236.89
7d_15C Seven days - 15 degrees Celsius 169.66 97.42 241.89
7d_30C Seven days - 30 degrees Celsius 268.98 161.35 376.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.290173 no
3d_25C 7d_25C 0.206427 no
3d_25C 7d_15C 0.214356 no
3d_25C 7d_30C 0.543485 no
3d_25C 10d_25C 0.193405 no
5d_25C 7d_25C 0.911973 no
5d_25C 7d_15C 0.898425 no
5d_25C 7d_30C 0.059176 no
5d_25C 10d_25C 0.892170 no
7d_25C 7d_15C 0.986346 no
7d_25C 7d_30C 0.033480 yes
7d_25C 10d_25C 0.983774 no
7d_15C 7d_30C 0.036939 yes
7d_15C 10d_25C 0.998067 no
7d_30C 10d_25C 0.032181 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7826.t1
MRFSTSAILVTALGWITAATAHTIQLKSHSRECFHESLHRDDVMTVTFQVGDREFGGSNNIEVDFWVEDPLRNRQ
YFKQAVASDDYSFTAQLDGKYNYCFSNEGWTSNSKEVSFNVHGIVYVPEHEMTQDPLEVEVRKLSEALTQVKDEQ
SYIVVRERVHRNTAESTNGRVKWWSMFQLMVVIGEGVFQVWWLKRFFEVKRVV*
Coding >Pro_DTO377G3_2|g7826.t1
ATGAGATTTTCAACAAGCGCAATCCTGGTCACCGCGCTGGGGTGGATCACCGCCGCGACCGCACACACCATCCAG
CTCAAGTCTCACTCACGAGAATGCTTCCACGAGTCACTGCACCGCGACGATGTCATGACTGTCACTTTCCAGGTT
GGAGATCGGGAGTTTGGAGGGAGCAATAACATTGAGGTTGATTTCTGGGTCGAGGATCCCCTGAGAAACCGCCAG
TACTTCAAGCAAGCTGTTGCCTCCGACGACTACTCCTTCACCGCACAGCTGGACGGGAAATACAACTACTGCTTC
AGCAACGAGGGCTGGACCTCCAACTCCAAGGAGGTCTCCTTCAACGTCCACGGAATTGTCTACGTGCCCGAACAT
GAGATGACGCAGGATCCCCTCGAGGTCGAAGTCCGCAAACTTAGCGAGGCTTTGACGCAGGTAAAGGATGAGCAG
TCGTACATCGTCGTGCGCGAGCGAGTGCACCGCAATACTGCAGAGAGCACGAACGGCCGCGTGAAGTGGTGGAGC
ATGTTCCAACTTATGGTGGTTATTGGCGAGGGTGTGTTCCAGGTGTGGTGGCTCAAGAGATTCTTCGAGGTCAAG
CGCGTGGTCTGA
Transcript >Pro_DTO377G3_2|g7826.t1
ATGAGATTTTCAACAAGCGCAATCCTGGTCACCGCGCTGGGGTGGATCACCGCCGCGACCGCACACACCATCCAG
CTCAAGTCTCACTCACGAGAATGCTTCCACGAGTCACTGCACCGCGACGATGTCATGACTGTCACTTTCCAGGTT
GGAGATCGGGAGTTTGGAGGGAGCAATAACATTGAGGTTGATTTCTGGGTCGAGGATCCCCTGAGAAACCGCCAG
TACTTCAAGCAAGCTGTTGCCTCCGACGACTACTCCTTCACCGCACAGCTGGACGGGAAATACAACTACTGCTTC
AGCAACGAGGGCTGGACCTCCAACTCCAAGGAGGTCTCCTTCAACGTCCACGGAATTGTCTACGTGCCCGAACAT
GAGATGACGCAGGATCCCCTCGAGGTCGAAGTCCGCAAACTTAGCGAGGCTTTGACGCAGGTAAAGGATGAGCAG
TCGTACATCGTCGTGCGCGAGCGAGTGCACCGCAATACTGCAGAGAGCACGAACGGCCGCGTGAAGTGGTGGAGC
ATGTTCCAACTTATGGTGGTTATTGGCGAGGGTGTGTTCCAGGTGTGGTGGCTCAAGAGATTCTTCGAGGTCAAG
CGCGTGGTCTGA
Gene >Pro_DTO377G3_2|g7826.t1
ATGAGATTTTCAACAAGCGCAATCCTGGTCACCGCGCTGGGGTGGATCACCGCCGCGACCGCACACACCATCCAG
CTCAAGTCTCACTCACGAGAATGCTTCCACGAGTCACTGCACCGCGACGATGTCATGACTGTCACTTTCCAGGTT
GGAGATCGGGAGTTTGGAGGGAGCAATAACATTGAGGTTGATTTCTGGGTATGAATTATCCCGGTGTTGCTAGGG
AGTCCGCTTCTGCTCTGATGGTGGCTCTGGCATGGGATATCGGATCTATAAACCGAGAGGTCTATGCCTACCTAC
GGACTAGGCCAGCTGCTAAATCATGATAGAGGAACGATTCAAAATAAGCTAGATGCTAACGCTCGGTCGTCGCAG
GTCGAGGATCCCCTGAGAAACCGCCAGTACTTCAAGCAAGCTGTTGCCTCCGACGACTACTCCTTCACCGCACAG
CTGGACGGGAAATACAACTACTGCTTCAGCAACGAGGGCTGGACCTCCAACTCCAAGGAGGTCTCCTTCAACGTC
CACGGAATTGTCTACGTGCCCGAACATGAGATGACGCAGGATCCCCTCGAGGTCGAAGGTAAGCGTGGGAAATAA
CAGCCGACGGAAGATGAAGGATATTGTGACTGATCATCTGGTACCATCTAGTCCGCAAACTTAGCGAGGCTTTGA
CGCAGGTAAAGGATGAGCAGTCGTACATCGTCGTGCGCGAGCGAGTGCACCGCAATACTGCAGAGAGCACGAACG
GCCGCGTGAAGTGGTGGAGCATGTTCCAACTTATGGTGGTTATTGGCGAGGGTGTGTTCCAGGTGTGGTGGCTCA
AGAGATTCTTCGAGGTACGTGGGTTCCTTTGATTGAGACACCGGAAGATGATATACTAATGCTCCATATTTAGGT
CAAGCGCGTGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail