Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7826.t1
Gene name
Locationscaffold_26:207925..208841
Strand+
Gene length (bp)916
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01105 EMP24_GP25L emp24/gp25L/p24 family/GOLD 4.3E-50 21 198

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7826.t1
MRFSTSAILVTALGWITAATAHTIQLKSHSRECFHESLHRDDVMTVTFQVGDREFGGSNNIEVDFWVEDPLRNRQ
YFKQAVASDDYSFTAQLDGKYNYCFSNEGWTSNSKEVSFNVHGIVYVPEHEMTQDPLEVEVRKLSEALTQVKDEQ
SYIVVRERVHRNTAESTNGRVKWWSMFQLMVVIGEGVFQVWWLKRFFEVKRVV*
Coding >Pro_DTO377G3_2|g7826.t1
ATGAGATTTTCAACAAGCGCAATCCTGGTCACCGCGCTGGGGTGGATCACCGCCGCGACCGCACACACCATCCAG
CTCAAGTCTCACTCACGAGAATGCTTCCACGAGTCACTGCACCGCGACGATGTCATGACTGTCACTTTCCAGGTT
GGAGATCGGGAGTTTGGAGGGAGCAATAACATTGAGGTTGATTTCTGGGTCGAGGATCCCCTGAGAAACCGCCAG
TACTTCAAGCAAGCTGTTGCCTCCGACGACTACTCCTTCACCGCACAGCTGGACGGGAAATACAACTACTGCTTC
AGCAACGAGGGCTGGACCTCCAACTCCAAGGAGGTCTCCTTCAACGTCCACGGAATTGTCTACGTGCCCGAACAT
GAGATGACGCAGGATCCCCTCGAGGTCGAAGTCCGCAAACTTAGCGAGGCTTTGACGCAGGTAAAGGATGAGCAG
TCGTACATCGTCGTGCGCGAGCGAGTGCACCGCAATACTGCAGAGAGCACGAACGGCCGCGTGAAGTGGTGGAGC
ATGTTCCAACTTATGGTGGTTATTGGCGAGGGTGTGTTCCAGGTGTGGTGGCTCAAGAGATTCTTCGAGGTCAAG
CGCGTGGTCTGA
Transcript >Pro_DTO377G3_2|g7826.t1
ATGAGATTTTCAACAAGCGCAATCCTGGTCACCGCGCTGGGGTGGATCACCGCCGCGACCGCACACACCATCCAG
CTCAAGTCTCACTCACGAGAATGCTTCCACGAGTCACTGCACCGCGACGATGTCATGACTGTCACTTTCCAGGTT
GGAGATCGGGAGTTTGGAGGGAGCAATAACATTGAGGTTGATTTCTGGGTCGAGGATCCCCTGAGAAACCGCCAG
TACTTCAAGCAAGCTGTTGCCTCCGACGACTACTCCTTCACCGCACAGCTGGACGGGAAATACAACTACTGCTTC
AGCAACGAGGGCTGGACCTCCAACTCCAAGGAGGTCTCCTTCAACGTCCACGGAATTGTCTACGTGCCCGAACAT
GAGATGACGCAGGATCCCCTCGAGGTCGAAGTCCGCAAACTTAGCGAGGCTTTGACGCAGGTAAAGGATGAGCAG
TCGTACATCGTCGTGCGCGAGCGAGTGCACCGCAATACTGCAGAGAGCACGAACGGCCGCGTGAAGTGGTGGAGC
ATGTTCCAACTTATGGTGGTTATTGGCGAGGGTGTGTTCCAGGTGTGGTGGCTCAAGAGATTCTTCGAGGTCAAG
CGCGTGGTCTGA
Gene >Pro_DTO377G3_2|g7826.t1
ATGAGATTTTCAACAAGCGCAATCCTGGTCACCGCGCTGGGGTGGATCACCGCCGCGACCGCACACACCATCCAG
CTCAAGTCTCACTCACGAGAATGCTTCCACGAGTCACTGCACCGCGACGATGTCATGACTGTCACTTTCCAGGTT
GGAGATCGGGAGTTTGGAGGGAGCAATAACATTGAGGTTGATTTCTGGGTATGAATTATCCCGGTGTTGCTAGGG
AGTCCGCTTCTGCTCTGATGGTGGCTCTGGCATGGGATATCGGATCTATAAACCGAGAGGTCTATGCCTACCTAC
GGACTAGGCCAGCTGCTAAATCATGATAGAGGAACGATTCAAAATAAGCTAGATGCTAACGCTCGGTCGTCGCAG
GTCGAGGATCCCCTGAGAAACCGCCAGTACTTCAAGCAAGCTGTTGCCTCCGACGACTACTCCTTCACCGCACAG
CTGGACGGGAAATACAACTACTGCTTCAGCAACGAGGGCTGGACCTCCAACTCCAAGGAGGTCTCCTTCAACGTC
CACGGAATTGTCTACGTGCCCGAACATGAGATGACGCAGGATCCCCTCGAGGTCGAAGGTAAGCGTGGGAAATAA
CAGCCGACGGAAGATGAAGGATATTGTGACTGATCATCTGGTACCATCTAGTCCGCAAACTTAGCGAGGCTTTGA
CGCAGGTAAAGGATGAGCAGTCGTACATCGTCGTGCGCGAGCGAGTGCACCGCAATACTGCAGAGAGCACGAACG
GCCGCGTGAAGTGGTGGAGCATGTTCCAACTTATGGTGGTTATTGGCGAGGGTGTGTTCCAGGTGTGGTGGCTCA
AGAGATTCTTCGAGGTACGTGGGTTCCTTTGATTGAGACACCGGAAGATGATATACTAATGCTCCATATTTAGGT
CAAGCGCGTGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail