Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7822.t1
Gene name
Locationscaffold_26:187187..191556
Strand-
Gene length (bp)4369
Transcript length (bp)4107
Coding sequence length (bp)4107
Protein length (aa) 1369

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 2.6E-83 750 1082
PF17849 OB_Dis3 Dis3-like cold-shock domain 2 (CSD2) 5.8E-26 644 719
PF17877 Dis3l2_C_term DIS3-like exonuclease 2 C terminal 2.1E-25 1134 1211

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0004540 ribonuclease activity Yes
GO:0003824 catalytic activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0140098 catalytic activity, acting on RNA No
GO:0004518 nuclease activity No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7822.t1
MDQQSQSGPQGPGGRKFHIAHRRSPSELTPLMMEQLAIQQQIELLQQQQQQIAATHQQYVNMGLLQPQQLGQVPS
FQPGASMGGVSPQQVNAFQFPQGGQQQQLGVPMNVPNQHSHRRNQSALPGLPMGPPPAPSSGASGYADYNQQGQN
NNNHKNENAGRGRGGPPGGGHQRRHSLALPEAKKAAELAQQKRTASGFQFPAPAPGAGSSDNQSSSDDKPVSTSP
APQGPAFQRAGNMRAGGHGRSQSMAIGGNRAAISGRGAGGFQFPQASEPVTNQSDNQRRPSQNGGHARSSSRNFE
GNWRQPNNQNQSQDQQRPIGQQQGGFQPGHRSRGSMNQSMGSIGQFQYGGQPQLGQPQLIQLPQGQVMMAPQMFG
NQQLNPLQLAQLQALQQNAQSMGGLQASQHAPPQMSVQQQQQQQRKTLFTPYLPQANLPALLSNGQLVAGVLRVN
KKNRSDAYVTTDDLDADIFICGSKDRNRALEGDYVAIELLDVDEVWGQKKEKEEKKKRKDITDARSNSTAGNDKL
GRSDSAGDRQEIGPDGSIRRRGSLRQRPTQKKNDDVEVEGQSLLLCEEDEISDEQKPLYAGHVVAVIERVAGQMF
SGTLGLLRPSSQATKEKQEAERQARDGAHGRSHNDRHQDKPKIVWFKPTDKRVPLIAIPTEQAPRDFVEKHQDYA
NRIFVASIKRWPITSLHPFGTLVEQLGEMGDLRVETDALLRDNNFGSDDFSDAVLKSIGWEDWSVSSEGDALASR
RDFREETIFTIDPADSKSLEDAFHVKSLADGKVEIGVHVADIAHFVKGNSLVDREAKKRGTAVYLVDRIMNMLPT
RVSTELCSLVPGEDRLTVSVVFKANPTTGVVDEDVWIGKGVIKSAGRLDYDQVNALVQDKSDVNTSGISADSIRL
LHNIVAKFREARFGNRVSNVPVQRLLQQLDDENVPVEYNIFESTPAHELVEELSHQANFFVARKLVSAMPERAFL
RRQFSPNSRRLTLFVERMNRLGFEMDSSSSGSLQSSLCKVEDVDLRKGMETLIAKAMQRAKYYVSNGAPDEMRQH
YMLNVPVYTHFTNPSRRYADILVHRQLEAVLSGGAVEFNDDIESLNKTADLCNNKKDSALNAQEQSVHIEACRKM
DRKSREIGGDLISEGIVLCVYESAFDVLIPEYGFEKRVHCDQLPLKKAEYRKDSRVLELYWEKGVPSSAYIPEDE
RPKPGNSRAAQAAAAARDAEAARERARERDEAMRKQTETGTMSADDVDALFDDDEDADEVTEMTAGVSLNSADRS
TQSMPPSPTRNGHHQQAPHRTRSDPKIASGTGDAPENKLTNKEKYLNLFKLREVDGEFIQDVTEMTRVPIILKTD
LSKSPPCLTVRSVNPYAL*
Coding >Pro_DTO377G3_2|g7822.t1
ATGGATCAACAGAGTCAATCTGGGCCTCAAGGCCCCGGTGGCCGCAAGTTCCATATTGCTCATCGGAGAAGTCCA
TCTGAGCTCACCCCGTTGATGATGGAACAACTGGCCATCCAACAACAGATCGAGTTGCTCCAGCAGCAGCAGCAA
CAAATTGCTGCGACACATCAACAATACGTTAACATGGGGCTGTTGCAGCCCCAGCAACTAGGCCAGGTGCCCTCG
TTTCAACCCGGTGCCTCCATGGGCGGTGTCTCCCCACAGCAAGTGAATGCATTCCAATTCCCACAGGGGGGACAG
CAGCAGCAGCTTGGAGTACCAATGAACGTACCGAACCAGCATTCGCACCGTCGCAACCAGTCTGCTCTCCCTGGT
CTTCCCATGGGCCCACCTCCTGCCCCGTCTTCCGGAGCGTCGGGATACGCCGATTATAACCAGCAGGGCCAAAAC
AACAATAACCACAAGAATGAGAACGCCGGTCGCGGTCGTGGAGGCCCTCCCGGCGGTGGTCACCAGCGCCGCCAC
TCGCTTGCTCTTCCTGAGGCCAAGAAAGCCGCCGAGCTGGCCCAGCAGAAGAGAACAGCTTCGGGATTCCAGTTC
CCAGCTCCTGCTCCTGGTGCAGGTAGTTCTGATAACCAGTCTTCATCGGATGACAAGCCTGTATCCACTTCCCCG
GCCCCCCAGGGACCCGCCTTCCAGCGGGCCGGAAATATGCGAGCTGGTGGCCATGGCCGCAGCCAATCGATGGCC
ATCGGTGGTAACCGGGCTGCCATTTCCGGTCGCGGTGCAGGCGGGTTCCAATTCCCCCAGGCCAGTGAGCCAGTA
ACCAATCAATCTGATAATCAACGACGACCCAGCCAGAACGGCGGCCATGCCCGGTCATCCTCGCGAAACTTCGAG
GGTAACTGGCGCCAGCCCAACAACCAAAATCAGAGCCAGGATCAGCAGAGACCCATCGGTCAGCAGCAGGGTGGA
TTCCAGCCCGGTCACCGCTCGCGCGGCTCGATGAACCAGTCCATGGGCTCTATTGGTCAATTCCAGTATGGCGGC
CAGCCCCAGCTTGGCCAGCCTCAGCTTATCCAACTTCCTCAGGGCCAAGTCATGATGGCACCTCAGATGTTCGGT
AATCAGCAACTGAACCCCCTCCAGCTGGCTCAGCTCCAAGCGCTTCAGCAGAACGCCCAAAGTATGGGTGGTCTC
CAGGCGAGCCAGCATGCCCCGCCGCAGATGTCTGTTCAACAGCAGCAGCAACAGCAGCGGAAGACTCTTTTCACT
CCTTACCTCCCCCAGGCAAACCTGCCTGCACTCCTTAGCAATGGACAATTGGTCGCTGGTGTTTTGCGCGTCAAC
AAAAAGAATCGTTCCGACGCTTATGTGACCACCGACGATCTGGATGCCGACATCTTCATTTGCGGTAGCAAAGAT
CGGAACCGCGCCCTCGAGGGTGACTATGTCGCAATCGAGCTTCTCGATGTCGACGAGGTGTGGGGTCAGAAGAAA
GAAAAGGAAGAAAAGAAGAAGCGCAAGGATATCACCGACGCCCGGTCTAACAGTACTGCTGGAAATGATAAGCTT
GGTCGCTCTGATTCTGCCGGCGATAGACAGGAAATTGGCCCGGATGGAAGCATCCGTCGCCGTGGTAGTCTTCGC
CAGCGTCCGACCCAGAAGAAGAATGACGATGTCGAGGTCGAGGGTCAGAGCCTTCTTCTTTGTGAGGAGGACGAG
ATCAGCGACGAGCAGAAGCCTTTGTACGCCGGTCATGTTGTTGCGGTCATTGAGCGTGTTGCGGGCCAGATGTTC
TCAGGAACCCTAGGTCTCTTGCGTCCCAGCAGCCAGGCTACAAAGGAGAAGCAGGAGGCCGAGCGGCAAGCCAGA
GATGGCGCTCATGGCCGTTCCCACAATGATCGTCACCAGGATAAGCCAAAGATTGTCTGGTTTAAGCCTACTGAC
AAGCGTGTTCCACTTATTGCCATCCCCACAGAGCAAGCACCTCGGGACTTCGTTGAGAAGCACCAGGATTACGCC
AACCGAATCTTTGTTGCTTCTATCAAGAGGTGGCCTATTACCTCTCTGCACCCCTTCGGTACTCTCGTTGAGCAG
CTTGGGGAGATGGGTGACTTGCGGGTTGAGACAGATGCCCTGCTCCGCGACAACAACTTCGGTTCGGATGATTTC
TCCGATGCTGTGCTGAAGAGCATCGGCTGGGAGGACTGGTCCGTCTCTAGCGAGGGAGACGCCCTTGCTTCGCGA
CGTGACTTCCGTGAAGAGACCATCTTTACGATTGACCCCGCCGACAGCAAGTCCCTCGAGGATGCGTTCCATGTG
AAGAGCCTTGCCGATGGCAAGGTCGAGATCGGTGTTCACGTGGCCGATATTGCTCACTTCGTCAAGGGTAATTCC
CTAGTAGACCGTGAGGCCAAGAAGCGTGGGACTGCAGTCTATCTAGTCGATCGGATCATGAACATGCTGCCTACC
CGTGTTTCCACTGAGCTTTGTTCCCTCGTCCCTGGCGAAGATCGCCTCACGGTCAGTGTGGTCTTCAAGGCCAAC
CCCACCACTGGTGTGGTGGATGAGGATGTCTGGATCGGCAAGGGTGTCATCAAGAGTGCTGGCCGTCTTGACTAC
GACCAAGTCAATGCACTTGTTCAGGACAAGTCTGATGTCAACACCAGTGGCATCTCTGCCGACAGCATCCGCTTG
TTGCATAACATTGTCGCCAAGTTCCGCGAAGCCCGCTTCGGTAACCGCGTATCAAACGTTCCTGTGCAGCGTCTG
CTTCAGCAGCTCGATGACGAGAATGTGCCAGTCGAATACAATATTTTCGAGTCAACTCCAGCACACGAACTTGTT
GAGGAGCTGAGCCACCAGGCCAACTTCTTTGTTGCTCGTAAGCTTGTCAGCGCTATGCCGGAGAGAGCTTTCTTG
CGTCGTCAGTTCTCGCCCAACTCTCGTCGCCTTACTTTGTTTGTTGAGCGGATGAATCGCCTTGGCTTCGAAATG
GATTCAAGCAGCAGTGGCAGCCTCCAGAGCTCTCTCTGCAAGGTCGAAGATGTGGATCTTCGAAAGGGTATGGAG
ACTCTCATTGCCAAGGCCATGCAGCGTGCCAAGTACTATGTCAGCAATGGTGCTCCCGATGAGATGCGCCAGCAC
TACATGCTCAATGTACCGGTTTACACCCACTTCACCAACCCCTCTCGGCGCTACGCCGATATCCTTGTGCATCGT
CAACTCGAGGCTGTGCTCTCCGGGGGTGCCGTGGAGTTCAATGACGATATTGAGTCACTGAACAAGACTGCGGAT
CTTTGCAACAACAAGAAGGACTCGGCTCTCAATGCCCAAGAGCAGAGTGTGCACATTGAGGCGTGCCGTAAAATG
GACCGCAAAAGTCGGGAGATTGGCGGTGATCTTATCAGCGAGGGCATTGTACTCTGCGTCTACGAGTCTGCCTTC
GACGTCCTTATTCCGGAATATGGCTTCGAAAAGCGTGTGCACTGCGACCAGCTGCCGCTCAAGAAGGCTGAATAC
CGCAAGGACAGTCGCGTACTCGAGCTGTACTGGGAGAAGGGTGTTCCCTCGTCCGCATATATTCCCGAGGACGAG
CGTCCCAAGCCCGGCAACTCCCGCGCTGCTCAAGCCGCAGCGGCTGCCCGCGATGCTGAAGCCGCTAGAGAGCGG
GCCAGAGAGCGTGATGAGGCCATGCGTAAGCAAACTGAGACCGGCACAATGTCTGCGGACGACGTCGATGCCCTT
TTCGATGACGACGAAGATGCGGATGAGGTGACTGAAATGACAGCCGGTGTGTCGCTCAACTCTGCCGATCGCTCG
ACTCAGAGCATGCCGCCATCGCCTACACGTAACGGCCACCACCAGCAGGCACCTCACCGTACTCGCTCGGATCCC
AAGATTGCCTCCGGAACTGGTGATGCACCCGAGAACAAATTGACCAACAAAGAGAAGTACTTGAACCTGTTCAAG
CTGCGCGAGGTGGATGGAGAGTTCATCCAGGATGTCACAGAGATGACCCGTGTTCCCATCATCTTGAAGACTGAC
CTGAGCAAGAGTCCTCCATGCCTCACTGTTCGATCTGTCAACCCCTACGCCCTGTAG
Transcript >Pro_DTO377G3_2|g7822.t1
ATGGATCAACAGAGTCAATCTGGGCCTCAAGGCCCCGGTGGCCGCAAGTTCCATATTGCTCATCGGAGAAGTCCA
TCTGAGCTCACCCCGTTGATGATGGAACAACTGGCCATCCAACAACAGATCGAGTTGCTCCAGCAGCAGCAGCAA
CAAATTGCTGCGACACATCAACAATACGTTAACATGGGGCTGTTGCAGCCCCAGCAACTAGGCCAGGTGCCCTCG
TTTCAACCCGGTGCCTCCATGGGCGGTGTCTCCCCACAGCAAGTGAATGCATTCCAATTCCCACAGGGGGGACAG
CAGCAGCAGCTTGGAGTACCAATGAACGTACCGAACCAGCATTCGCACCGTCGCAACCAGTCTGCTCTCCCTGGT
CTTCCCATGGGCCCACCTCCTGCCCCGTCTTCCGGAGCGTCGGGATACGCCGATTATAACCAGCAGGGCCAAAAC
AACAATAACCACAAGAATGAGAACGCCGGTCGCGGTCGTGGAGGCCCTCCCGGCGGTGGTCACCAGCGCCGCCAC
TCGCTTGCTCTTCCTGAGGCCAAGAAAGCCGCCGAGCTGGCCCAGCAGAAGAGAACAGCTTCGGGATTCCAGTTC
CCAGCTCCTGCTCCTGGTGCAGGTAGTTCTGATAACCAGTCTTCATCGGATGACAAGCCTGTATCCACTTCCCCG
GCCCCCCAGGGACCCGCCTTCCAGCGGGCCGGAAATATGCGAGCTGGTGGCCATGGCCGCAGCCAATCGATGGCC
ATCGGTGGTAACCGGGCTGCCATTTCCGGTCGCGGTGCAGGCGGGTTCCAATTCCCCCAGGCCAGTGAGCCAGTA
ACCAATCAATCTGATAATCAACGACGACCCAGCCAGAACGGCGGCCATGCCCGGTCATCCTCGCGAAACTTCGAG
GGTAACTGGCGCCAGCCCAACAACCAAAATCAGAGCCAGGATCAGCAGAGACCCATCGGTCAGCAGCAGGGTGGA
TTCCAGCCCGGTCACCGCTCGCGCGGCTCGATGAACCAGTCCATGGGCTCTATTGGTCAATTCCAGTATGGCGGC
CAGCCCCAGCTTGGCCAGCCTCAGCTTATCCAACTTCCTCAGGGCCAAGTCATGATGGCACCTCAGATGTTCGGT
AATCAGCAACTGAACCCCCTCCAGCTGGCTCAGCTCCAAGCGCTTCAGCAGAACGCCCAAAGTATGGGTGGTCTC
CAGGCGAGCCAGCATGCCCCGCCGCAGATGTCTGTTCAACAGCAGCAGCAACAGCAGCGGAAGACTCTTTTCACT
CCTTACCTCCCCCAGGCAAACCTGCCTGCACTCCTTAGCAATGGACAATTGGTCGCTGGTGTTTTGCGCGTCAAC
AAAAAGAATCGTTCCGACGCTTATGTGACCACCGACGATCTGGATGCCGACATCTTCATTTGCGGTAGCAAAGAT
CGGAACCGCGCCCTCGAGGGTGACTATGTCGCAATCGAGCTTCTCGATGTCGACGAGGTGTGGGGTCAGAAGAAA
GAAAAGGAAGAAAAGAAGAAGCGCAAGGATATCACCGACGCCCGGTCTAACAGTACTGCTGGAAATGATAAGCTT
GGTCGCTCTGATTCTGCCGGCGATAGACAGGAAATTGGCCCGGATGGAAGCATCCGTCGCCGTGGTAGTCTTCGC
CAGCGTCCGACCCAGAAGAAGAATGACGATGTCGAGGTCGAGGGTCAGAGCCTTCTTCTTTGTGAGGAGGACGAG
ATCAGCGACGAGCAGAAGCCTTTGTACGCCGGTCATGTTGTTGCGGTCATTGAGCGTGTTGCGGGCCAGATGTTC
TCAGGAACCCTAGGTCTCTTGCGTCCCAGCAGCCAGGCTACAAAGGAGAAGCAGGAGGCCGAGCGGCAAGCCAGA
GATGGCGCTCATGGCCGTTCCCACAATGATCGTCACCAGGATAAGCCAAAGATTGTCTGGTTTAAGCCTACTGAC
AAGCGTGTTCCACTTATTGCCATCCCCACAGAGCAAGCACCTCGGGACTTCGTTGAGAAGCACCAGGATTACGCC
AACCGAATCTTTGTTGCTTCTATCAAGAGGTGGCCTATTACCTCTCTGCACCCCTTCGGTACTCTCGTTGAGCAG
CTTGGGGAGATGGGTGACTTGCGGGTTGAGACAGATGCCCTGCTCCGCGACAACAACTTCGGTTCGGATGATTTC
TCCGATGCTGTGCTGAAGAGCATCGGCTGGGAGGACTGGTCCGTCTCTAGCGAGGGAGACGCCCTTGCTTCGCGA
CGTGACTTCCGTGAAGAGACCATCTTTACGATTGACCCCGCCGACAGCAAGTCCCTCGAGGATGCGTTCCATGTG
AAGAGCCTTGCCGATGGCAAGGTCGAGATCGGTGTTCACGTGGCCGATATTGCTCACTTCGTCAAGGGTAATTCC
CTAGTAGACCGTGAGGCCAAGAAGCGTGGGACTGCAGTCTATCTAGTCGATCGGATCATGAACATGCTGCCTACC
CGTGTTTCCACTGAGCTTTGTTCCCTCGTCCCTGGCGAAGATCGCCTCACGGTCAGTGTGGTCTTCAAGGCCAAC
CCCACCACTGGTGTGGTGGATGAGGATGTCTGGATCGGCAAGGGTGTCATCAAGAGTGCTGGCCGTCTTGACTAC
GACCAAGTCAATGCACTTGTTCAGGACAAGTCTGATGTCAACACCAGTGGCATCTCTGCCGACAGCATCCGCTTG
TTGCATAACATTGTCGCCAAGTTCCGCGAAGCCCGCTTCGGTAACCGCGTATCAAACGTTCCTGTGCAGCGTCTG
CTTCAGCAGCTCGATGACGAGAATGTGCCAGTCGAATACAATATTTTCGAGTCAACTCCAGCACACGAACTTGTT
GAGGAGCTGAGCCACCAGGCCAACTTCTTTGTTGCTCGTAAGCTTGTCAGCGCTATGCCGGAGAGAGCTTTCTTG
CGTCGTCAGTTCTCGCCCAACTCTCGTCGCCTTACTTTGTTTGTTGAGCGGATGAATCGCCTTGGCTTCGAAATG
GATTCAAGCAGCAGTGGCAGCCTCCAGAGCTCTCTCTGCAAGGTCGAAGATGTGGATCTTCGAAAGGGTATGGAG
ACTCTCATTGCCAAGGCCATGCAGCGTGCCAAGTACTATGTCAGCAATGGTGCTCCCGATGAGATGCGCCAGCAC
TACATGCTCAATGTACCGGTTTACACCCACTTCACCAACCCCTCTCGGCGCTACGCCGATATCCTTGTGCATCGT
CAACTCGAGGCTGTGCTCTCCGGGGGTGCCGTGGAGTTCAATGACGATATTGAGTCACTGAACAAGACTGCGGAT
CTTTGCAACAACAAGAAGGACTCGGCTCTCAATGCCCAAGAGCAGAGTGTGCACATTGAGGCGTGCCGTAAAATG
GACCGCAAAAGTCGGGAGATTGGCGGTGATCTTATCAGCGAGGGCATTGTACTCTGCGTCTACGAGTCTGCCTTC
GACGTCCTTATTCCGGAATATGGCTTCGAAAAGCGTGTGCACTGCGACCAGCTGCCGCTCAAGAAGGCTGAATAC
CGCAAGGACAGTCGCGTACTCGAGCTGTACTGGGAGAAGGGTGTTCCCTCGTCCGCATATATTCCCGAGGACGAG
CGTCCCAAGCCCGGCAACTCCCGCGCTGCTCAAGCCGCAGCGGCTGCCCGCGATGCTGAAGCCGCTAGAGAGCGG
GCCAGAGAGCGTGATGAGGCCATGCGTAAGCAAACTGAGACCGGCACAATGTCTGCGGACGACGTCGATGCCCTT
TTCGATGACGACGAAGATGCGGATGAGGTGACTGAAATGACAGCCGGTGTGTCGCTCAACTCTGCCGATCGCTCG
ACTCAGAGCATGCCGCCATCGCCTACACGTAACGGCCACCACCAGCAGGCACCTCACCGTACTCGCTCGGATCCC
AAGATTGCCTCCGGAACTGGTGATGCACCCGAGAACAAATTGACCAACAAAGAGAAGTACTTGAACCTGTTCAAG
CTGCGCGAGGTGGATGGAGAGTTCATCCAGGATGTCACAGAGATGACCCGTGTTCCCATCATCTTGAAGACTGAC
CTGAGCAAGAGTCCTCCATGCCTCACTGTTCGATCTGTCAACCCCTACGCCCTGTAG
Gene >Pro_DTO377G3_2|g7822.t1
ATGGATCAACAGAGTCAATCTGGGCCTCAAGGCCCCGGTGGCCGCAAGTTCCATATTGCTCATCGGAGAAGTCCA
TCTGAGCTCACCCCGTTGATGAGTATGTGACCGCTCTCGTGACCGCTTACTATATAACCATTCGTCCCATCATAT
CAGCTAACTTGAGCTTGTCTACAGTGGAACAACTGGCCATCCAACAACAGATCGAGTTGCTCCAGCAGCAGCAGC
AACAAATTGCTGCGACACATCAACAATACGTTAACATGGGGCTGTTGCAGCCCCAGCAACTAGGCCAGGTGCCCT
CGTTTCAACCCGGTGCCTCCATGGGCGGTGTCTCCCCACAGCAAGTGAATGCATTCCAATTCCCACAGGGGGGAC
AGCAGCAGCAGCTTGGAGTACCAATGAACGTACCGAACCAGCATTCGCACCGTCGCAACCAGTCTGCTCTCCCTG
GTCTTCCCATGGGCCCACCTCCTGCCCCGTCTTCCGGAGCGTCGGGATACGCCGATTATAACCAGCAGGGCCAAA
ACAACAATAACCACAAGAATGAGAACGCCGGTCGCGGTCGTGGAGGCCCTCCCGGCGGTGGTCACCAGCGCCGCC
ACTCGCTTGCTCTTCCTGAGGCCAAGAAAGCCGCCGAGCTGGCCCAGCAGAAGAGAACAGCTTCGGGATTCCAGT
TCCCAGCTCCTGCTCCTGGTGCAGGTAGTTCTGATAACCAGTCTTCATCGGATGACAAGCCTGTATCCACTTCCC
CGGCCCCCCAGGGACCCGCCTTCCAGCGGGCCGGAAATATGCGAGCTGGTGGCCATGGCCGCAGCCAATCGATGG
CCATCGGTGGTAACCGGGCTGCCATTTCCGGTCGCGGTGCAGGCGGGTTCCAATTCCCCCAGGCCAGTGAGCCAG
TAACCAATCAATCTGATAATCAACGACGACCCAGCCAGAACGGCGGCCATGCCCGGTCATCCTCGCGAAACTTCG
AGGGTAACTGGCGCCAGCCCAACAACCAAAATCAGAGCCAGGATCAGCAGAGACCCATCGGTCAGCAGCAGGGTG
GATTCCAGCCCGGTCACCGCTCGCGCGGCTCGATGAACCAGTCCATGGGCTCTATTGGTCAATTCCAGTATGGCG
GCCAGCCCCAGCTTGGCCAGCCTCAGCTTATCCAACTTCCTCAGGGCCAAGTCATGATGGCACCTCAGATGTTCG
GTAATCAGCAACTGAACCCCCTCCAGCTGGCTCAGCTCCAAGCGCTTCAGCAGAACGCCCAAAGTATGGGTGGTC
TCCAGGCGAGCCAGCATGCCCCGCCGCAGATGTCTGTTCAACAGCAGCAGCAACAGCAGCGGAAGACTCTTTTCA
CTCCTTACCTCCCCCAGGCAAACCTGCCTGCACTCCTTAGCAATGGACAATTGGTCGCTGGTGTTTTGCGCGTCA
ACAAAAAGAATCGTTCCGACGCTTATGTGACCACCGACGATCTGGATGCCGACATCTTCATTTGCGGTAGCAAAG
ATCGGAACCGCGCCCTCGAGGGTGACTATGTCGCAATCGAGCTTCTCGATGTCGACGAGGTGTGGGGTCAGAAGA
AAGAAAAGGAAGAAAAGAAGAAGCGCAAGGATATCACCGACGCCCGGTCTAACAGTACTGCTGGAAATGATAAGC
TTGGTCGCTCTGATTCTGCCGGCGATAGACAGGAAATTGGCCCGGATGGAAGCATCCGTCGCCGTGGTAGTCTTC
GCCAGCGTCCGACCCAGAAGAAGAATGACGATGTCGAGGTCGAGGGTCAGAGCCTTCTTCTTTGTGAGGAGGACG
AGATCAGCGACGAGCAGAAGCCTTTGTACGCCGGTCATGTTGTTGCGGTCATTGAGCGTGTTGCGGGCCAGATGT
TCTCAGGAACCCTAGGTCTCTTGCGTCCCAGCAGCCAGGCTACAAAGGAGAAGCAGGAGGCCGAGCGGCAAGCCA
GAGATGGCGCTCATGGCCGTTCCCACAATGATCGTCACCAGGATAAGCCAAAGATTGTCTGGTTTAAGCCTACTG
ACAAGCGTGTTCCACTTATTGCCATCCCCACAGAGCAAGCACCTCGGGACTTCGTTGAGAAGCACCAGGATTACG
CCAACCGAATCTTTGTTGCTTCTATCAAGAGGTGGCCTATTACCTCTCTGCACCCCTTCGGTACTCTCGTTGAGC
AGCTTGGGGAGATGGGTGACTTGCGGGTTGAGACAGATGCCCTGCTCCGCGACAACAACTTCGGTTCGGATGATT
TCTCCGATGCTGTGCTGAAGAGCATCGGCTGGGAGGACTGGTCCGTCTCTAGCGAGGGAGACGCCCTTGCTTCGC
GACGTGACTTCCGTGAAGAGACCATCTTTACGATTGACCCCGCCGACAGCAAGTCCCTCGAGGATGCGTTCCATG
TGAAGAGCCTTGCCGATGGCAAGGTCGAGATCGGTGTTCACGTGGCCGATATTGCTCACTTCGTCAAGGGTAATT
CCCTAGTAGACCGTGAGGCCAAGAAGCGTGGGACTGCAGTCTATCTAGTCGATCGGATCATGAACATGCTGCCTA
CCCGTGTTTCCACTGAGCTTTGTTCCCTCGTCCCTGGCGAAGATCGCCTCACGGTCAGTGTGGTCTTCAAGGCCA
ACCCCACCACTGGTGTGGTGGATGAGGATGTCTGGATCGGCAAGGGTGTCATCAAGAGTGCTGGCCGTCTTGACT
ACGACCAAGTCAATGCACTTGTTCAGGACAAGTCTGATGTCAACACCAGTGGCATCTCTGCCGACAGCATCCGCT
TGTTGCATGTAAGTTTTTTCTGATCCTACCATTCTTCTTATTTTCCCCCATGCTAATAGTAACACTCAGAACATT
GTCGCCAAGTTCCGCGAAGCCCGCTTCGGTAACCGCGTATCAAACGTTCCTGTGCAGCGTCTGCTTCAGCAGCTC
GATGACGAGAATGTGCCAGTCGAATACAATATTTTCGAGTCAACTCCAGCACACGAACTTGTTGAGGAGCTGAGC
CACCAGGCCAACTTCTTTGTTGCTCGTAAGCTTGTCAGCGCTATGCCGGAGAGAGCTTTCTTGCGTCGTCAGTTC
TCGCCCAACTCTCGTCGCCTTACTTTGTTTGTTGAGCGGATGAATCGCCTTGGCTTCGAAATGGATTCAAGCAGC
AGTGGCAGCCTCCAGAGCTCTCTCTGCAAGGTCGAAGATGTGGATCTTCGAAAGGTAAGCACATTTTCTGTTCTC
CCAGTCATAAATACATATTAACACGTGATACAGGGTATGGAGACTCTCATTGCCAAGGCCATGCAGCGTGCCAAG
TACTATGTCAGCAATGGTGCTCCCGATGAGATGCGCCAGCACTACATGCTCAATGTACCGGTTTACACCCACTTC
ACCAACCCCTCTCGGCGCTACGCCGATATCCTTGTGCATCGTCAACTCGAGGCTGTGCTCTCCGGGGGTGCCGTG
GAGTTCAATGACGATATTGAGTCACTGAACAAGACTGCGGATCTTTGCAACAACAAGAAGGACTCGGCTCTCAAT
GCCCAAGAGCAGAGTGTGCACATTGAGGCGTGCCGTAAAATGGACCGCAAAAGTCGGGAGATTGGCGGTGATCTT
ATCAGCGAGGGCATTGTACTCTGCGTCTACGAGTCTGCCTTCGACGTCCTTATTCCGGAATATGGCTTCGAAAAG
CGTGTGCACTGCGACCAGCTGCCGCTCAAGAAGGCTGAATACCGCAAGGACAGTCGCGTACTCGAGCTGTACTGG
GAGAAGGGTGTTCCCTCGTCCGCATATATTCCCGAGGACGAGCGTCCCAAGCCCGGCAACTCCCGCGCTGCTCAA
GCCGCAGCGGCTGCCCGCGATGCTGAAGCCGCTAGAGAGCGGGCCAGAGAGCGTGATGAGGCCATGCGTAAGCAA
ACTGAGACCGGCACAATGTCTGCGGACGACGTCGATGCCCTTTTCGATGACGACGAAGATGCGGATGAGGTGACT
GAAATGACAGCCGGTGTGTCGCTCAACTCTGCCGATCGCTCGACTCAGAGCATGCCGCCATCGCCTACACGTAAC
GGCCACCACCAGCAGGCACCTCACCGTACTCGCTCGGATCCCAAGATTGCCTCCGGAACTGGTGATGCACCCGAG
AACAAATTGACCAACAAAGAGAAGTACTTGAACCTGTTCAAGCTGCGCGAGGTGGATGGAGAGTTCATCCAGGAT
GTCACAGAGATGACCCGTGTTCCCATCATCTTGAAGACTGACCTGAGCAAGAGTCCTCCGTAAGTGTTCCCATTC
AGCTTTTTTCTTTTTCTAGCATGGGTGTCCCTAACTAACTTATTTCTATTCCAGATGCCTCACTGTTCGATCTGT
CAACCCCTACGCCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail