Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7817.t1
Gene name
Locationscaffold_26:175294..177679
Strand-
Gene length (bp)2385
Transcript length (bp)2385
Coding sequence length (bp)2385
Protein length (aa) 795

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 5.9E-44 516 689
PF17871 AAA_lid_9 AAA lid domain 1.2E-35 261 363
PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein 3.1E-26 696 776
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.9E-10 123 254
PF00004 AAA ATPase family associated with various cellular activities (AAA) 1.7E-05 522 639
PF07728 AAA_5 AAA domain (dynein-related subfamily) 7.2E-08 521 638
PF00158 Sigma54_activat Sigma-54 interaction domain 2.7E-04 519 627

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008134 transcription factor binding Yes
GO:0016887 ATPase activity Yes
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0017111 nucleoside-triphosphatase activity No
GO:0043168 anion binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0051252 regulation of RNA metabolic process No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0003824 catalytic activity No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0031326 regulation of cellular biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:0097159 organic cyclic compound binding No
GO:0005515 protein binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0065007 biological regulation No
GO:0050789 regulation of biological process No
GO:0003674 molecular_function No
GO:0009889 regulation of biosynthetic process No
GO:0036094 small molecule binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:0043167 ion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0016787 hydrolase activity No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7817.t1
MAARLSLNARSRLLRTPRLSSTRLLSPIPRSSILPCTSIIPPAINHSPISVRNYANGGRPHPPGGTHRMDMSGGE
DEKSALEKYGVELTEKAKAGKLDPVIGRDAEIHRTIQILSRRTKNNPVLIGSAGTGKTAVLEGLAQRIVQGDVPE
SIKNKRVVSLDLGSLIAGAKFRGDFEERLKAVLKEVEDAEGGVILFIDELHTLLGLGKAEGSIDASNLLKPALSR
GELQCCGATTLNEYRLIEKDVALARRFQPILVSEPSVASTISILRGIKNKYEVHHGVRITDGALVAAATYSNRYI
TDRFLPDKAIDLVDEAASALRLQQESKPDSIRELERDITTIQIELESLRKETDVASRERREKLQEDLKTKQAEAS
KLTEAWEEEKAEIDTIKRTKENLERARFELEQAQREGNFAKAGELRYSTIPELEAKLPKEGAEQDPHNQTLIHDS
VTADDIGNVVSRTTGIPVNKLMAGDVEKLIHMEDTLRKSVRGQDEALSAVANAVRMQRAGLSGENRPMASFMFLG
PTGVGKTELCKKMAEFLFSTETAVLRFDMSEFQEKHTISRLIGSPAGYVGYDDAGQLTEAVRRKPYAVLLFDEFE
KAHRDISALLLQVLDEGFLTDAQGHKVDFRNTLIVLTSNLGASILVGADPLYPIKDDAGDAELPEKVKSAVMDVV
QSAYPPEFMNRIDEFIIFRRLSQDALRDIVDIRIKELQARLDDRRMTLQVDNETKDWLCEKGYDPKFGARPLNRL
IAKEIGNRLADKIIRGEIVSGQTARVSLDESKSGLVVTAETAEE*
Coding >Pro_DTO377G3_2|g7817.t1
ATGGCGGCGAGATTATCCCTCAATGCCCGCAGTCGGCTTCTGCGAACGCCTCGCCTATCTTCGACCCGGCTTCTA
TCCCCAATCCCGAGATCAAGCATACTACCCTGCACCTCTATCATACCACCAGCCATCAACCATAGCCCTATATCT
GTCCGCAACTATGCCAACGGGGGCCGTCCACACCCTCCAGGCGGTACTCACCGTATGGATATGAGCGGCGGAGAG
GACGAGAAATCAGCACTAGAAAAGTATGGTGTTGAGCTTACGGAGAAAGCTAAAGCTGGCAAGCTGGATCCAGTC
ATTGGACGGGATGCCGAGATTCATCGAACCATCCAAATTCTGTCCAGGCGAACTAAGAACAACCCCGTACTGATC
GGTTCCGCTGGAACCGGTAAGACCGCCGTTCTCGAAGGGCTGGCTCAGCGTATCGTACAAGGAGATGTCCCCGAG
AGCATCAAAAACAAACGGGTTGTCTCATTGGACCTGGGCTCTCTAATTGCAGGAGCCAAGTTCCGGGGTGACTTC
GAGGAGCGTCTGAAAGCCGTCCTGAAGGAAGTGGAGGATGCAGAAGGCGGGGTGATCCTCTTCATTGACGAGCTT
CACACCTTGCTGGGACTTGGCAAGGCTGAGGGCAGCATTGATGCTAGTAATCTTCTCAAGCCTGCTTTGTCGCGA
GGCGAGCTTCAATGCTGTGGTGCCACTACTCTGAATGAATATCGATTGATTGAAAAAGATGTGGCTCTTGCCCGA
CGGTTCCAGCCTATTCTGGTGAGTGAGCCGTCGGTCGCCTCGACTATTTCCATTCTACGGGGCATCAAGAACAAA
TACGAAGTACATCATGGTGTCAGAATTACAGATGGCGCTTTAGTAGCTGCAGCCACTTACAGTAATCGCTACATC
ACCGATCGATTCCTGCCCGACAAAGCGATTGATCTTGTCGATGAAGCTGCATCGGCTCTTCGCTTGCAACAGGAG
TCGAAACCCGACTCGATTCGGGAACTTGAACGTGACATTACTACCATCCAAATTGAGCTTGAGTCTCTTCGCAAG
GAAACCGATGTTGCCAGCCGCGAACGGCGAGAGAAGCTTCAAGAAGACCTGAAGACCAAGCAAGCGGAGGCCAGT
AAATTGACCGAGGCCTGGGAAGAGGAGAAGGCCGAAATTGATACCATCAAACGCACCAAGGAGAATTTAGAACGC
GCTCGGTTTGAACTTGAACAAGCTCAACGCGAAGGAAACTTTGCCAAGGCTGGAGAATTGAGATACTCTACCATC
CCAGAGCTCGAAGCCAAGCTACCCAAAGAAGGCGCTGAACAGGATCCTCATAATCAAACTCTGATTCACGACTCA
GTTACTGCAGATGACATTGGAAACGTCGTTTCTCGGACCACAGGCATCCCCGTTAACAAGCTCATGGCTGGAGAC
GTGGAGAAGTTGATTCATATGGAGGACACTCTCCGAAAATCAGTCCGCGGACAAGATGAAGCGCTTTCTGCTGTG
GCAAATGCTGTGCGGATGCAGAGAGCTGGTCTCAGCGGAGAAAATCGCCCTATGGCCTCTTTCATGTTCCTTGGT
CCCACCGGTGTTGGAAAGACTGAGCTCTGCAAGAAGATGGCCGAGTTCCTTTTCTCCACGGAAACTGCAGTTTTA
CGGTTTGACATGAGTGAATTCCAGGAGAAGCACACAATCAGTCGACTCATTGGTTCTCCTGCCGGATATGTTGGA
TATGATGATGCTGGTCAGCTCACCGAGGCTGTCAGACGGAAGCCTTACGCTGTTCTGCTATTTGATGAATTCGAG
AAGGCTCATCGTGATATCTCAGCGCTCCTGCTGCAGGTCCTCGATGAGGGCTTCCTGACAGATGCGCAAGGCCAC
AAGGTTGATTTCCGAAACACCCTGATTGTGTTGACCTCGAATCTTGGAGCTAGTATCCTGGTCGGAGCAGACCCC
TTGTACCCAATTAAAGATGACGCCGGTGATGCCGAGCTCCCAGAAAAGGTCAAATCGGCTGTTATGGATGTGGTT
CAGAGCGCATACCCACCTGAGTTCATGAACCGAATCGATGAATTCATCATCTTCAGACGCCTGTCCCAGGATGCT
CTCCGGGACATCGTCGATATCAGAATCAAAGAGCTTCAGGCTAGACTCGATGACCGCCGTATGACTCTGCAGGTT
GACAATGAGACTAAGGACTGGCTGTGCGAGAAAGGCTACGACCCCAAATTTGGTGCCCGGCCTTTGAACCGTCTC
ATTGCTAAGGAGATTGGAAACCGCTTGGCTGATAAGATCATCCGAGGTGAAATTGTCTCTGGTCAAACTGCCCGA
GTTTCTCTTGATGAGTCTAAGTCTGGCCTTGTGGTAACTGCGGAGACCGCGGAAGAATAA
Transcript >Pro_DTO377G3_2|g7817.t1
ATGGCGGCGAGATTATCCCTCAATGCCCGCAGTCGGCTTCTGCGAACGCCTCGCCTATCTTCGACCCGGCTTCTA
TCCCCAATCCCGAGATCAAGCATACTACCCTGCACCTCTATCATACCACCAGCCATCAACCATAGCCCTATATCT
GTCCGCAACTATGCCAACGGGGGCCGTCCACACCCTCCAGGCGGTACTCACCGTATGGATATGAGCGGCGGAGAG
GACGAGAAATCAGCACTAGAAAAGTATGGTGTTGAGCTTACGGAGAAAGCTAAAGCTGGCAAGCTGGATCCAGTC
ATTGGACGGGATGCCGAGATTCATCGAACCATCCAAATTCTGTCCAGGCGAACTAAGAACAACCCCGTACTGATC
GGTTCCGCTGGAACCGGTAAGACCGCCGTTCTCGAAGGGCTGGCTCAGCGTATCGTACAAGGAGATGTCCCCGAG
AGCATCAAAAACAAACGGGTTGTCTCATTGGACCTGGGCTCTCTAATTGCAGGAGCCAAGTTCCGGGGTGACTTC
GAGGAGCGTCTGAAAGCCGTCCTGAAGGAAGTGGAGGATGCAGAAGGCGGGGTGATCCTCTTCATTGACGAGCTT
CACACCTTGCTGGGACTTGGCAAGGCTGAGGGCAGCATTGATGCTAGTAATCTTCTCAAGCCTGCTTTGTCGCGA
GGCGAGCTTCAATGCTGTGGTGCCACTACTCTGAATGAATATCGATTGATTGAAAAAGATGTGGCTCTTGCCCGA
CGGTTCCAGCCTATTCTGGTGAGTGAGCCGTCGGTCGCCTCGACTATTTCCATTCTACGGGGCATCAAGAACAAA
TACGAAGTACATCATGGTGTCAGAATTACAGATGGCGCTTTAGTAGCTGCAGCCACTTACAGTAATCGCTACATC
ACCGATCGATTCCTGCCCGACAAAGCGATTGATCTTGTCGATGAAGCTGCATCGGCTCTTCGCTTGCAACAGGAG
TCGAAACCCGACTCGATTCGGGAACTTGAACGTGACATTACTACCATCCAAATTGAGCTTGAGTCTCTTCGCAAG
GAAACCGATGTTGCCAGCCGCGAACGGCGAGAGAAGCTTCAAGAAGACCTGAAGACCAAGCAAGCGGAGGCCAGT
AAATTGACCGAGGCCTGGGAAGAGGAGAAGGCCGAAATTGATACCATCAAACGCACCAAGGAGAATTTAGAACGC
GCTCGGTTTGAACTTGAACAAGCTCAACGCGAAGGAAACTTTGCCAAGGCTGGAGAATTGAGATACTCTACCATC
CCAGAGCTCGAAGCCAAGCTACCCAAAGAAGGCGCTGAACAGGATCCTCATAATCAAACTCTGATTCACGACTCA
GTTACTGCAGATGACATTGGAAACGTCGTTTCTCGGACCACAGGCATCCCCGTTAACAAGCTCATGGCTGGAGAC
GTGGAGAAGTTGATTCATATGGAGGACACTCTCCGAAAATCAGTCCGCGGACAAGATGAAGCGCTTTCTGCTGTG
GCAAATGCTGTGCGGATGCAGAGAGCTGGTCTCAGCGGAGAAAATCGCCCTATGGCCTCTTTCATGTTCCTTGGT
CCCACCGGTGTTGGAAAGACTGAGCTCTGCAAGAAGATGGCCGAGTTCCTTTTCTCCACGGAAACTGCAGTTTTA
CGGTTTGACATGAGTGAATTCCAGGAGAAGCACACAATCAGTCGACTCATTGGTTCTCCTGCCGGATATGTTGGA
TATGATGATGCTGGTCAGCTCACCGAGGCTGTCAGACGGAAGCCTTACGCTGTTCTGCTATTTGATGAATTCGAG
AAGGCTCATCGTGATATCTCAGCGCTCCTGCTGCAGGTCCTCGATGAGGGCTTCCTGACAGATGCGCAAGGCCAC
AAGGTTGATTTCCGAAACACCCTGATTGTGTTGACCTCGAATCTTGGAGCTAGTATCCTGGTCGGAGCAGACCCC
TTGTACCCAATTAAAGATGACGCCGGTGATGCCGAGCTCCCAGAAAAGGTCAAATCGGCTGTTATGGATGTGGTT
CAGAGCGCATACCCACCTGAGTTCATGAACCGAATCGATGAATTCATCATCTTCAGACGCCTGTCCCAGGATGCT
CTCCGGGACATCGTCGATATCAGAATCAAAGAGCTTCAGGCTAGACTCGATGACCGCCGTATGACTCTGCAGGTT
GACAATGAGACTAAGGACTGGCTGTGCGAGAAAGGCTACGACCCCAAATTTGGTGCCCGGCCTTTGAACCGTCTC
ATTGCTAAGGAGATTGGAAACCGCTTGGCTGATAAGATCATCCGAGGTGAAATTGTCTCTGGTCAAACTGCCCGA
GTTTCTCTTGATGAGTCTAAGTCTGGCCTTGTGGTAACTGCGGAGACCGCGGAAGAATAA
Gene >Pro_DTO377G3_2|g7817.t1
ATGGCGGCGAGATTATCCCTCAATGCCCGCAGTCGGCTTCTGCGAACGCCTCGCCTATCTTCGACCCGGCTTCTA
TCCCCAATCCCGAGATCAAGCATACTACCCTGCACCTCTATCATACCACCAGCCATCAACCATAGCCCTATATCT
GTCCGCAACTATGCCAACGGGGGCCGTCCACACCCTCCAGGCGGTACTCACCGTATGGATATGAGCGGCGGAGAG
GACGAGAAATCAGCACTAGAAAAGTATGGTGTTGAGCTTACGGAGAAAGCTAAAGCTGGCAAGCTGGATCCAGTC
ATTGGACGGGATGCCGAGATTCATCGAACCATCCAAATTCTGTCCAGGCGAACTAAGAACAACCCCGTACTGATC
GGTTCCGCTGGAACCGGTAAGACCGCCGTTCTCGAAGGGCTGGCTCAGCGTATCGTACAAGGAGATGTCCCCGAG
AGCATCAAAAACAAACGGGTTGTCTCATTGGACCTGGGCTCTCTAATTGCAGGAGCCAAGTTCCGGGGTGACTTC
GAGGAGCGTCTGAAAGCCGTCCTGAAGGAAGTGGAGGATGCAGAAGGCGGGGTGATCCTCTTCATTGACGAGCTT
CACACCTTGCTGGGACTTGGCAAGGCTGAGGGCAGCATTGATGCTAGTAATCTTCTCAAGCCTGCTTTGTCGCGA
GGCGAGCTTCAATGCTGTGGTGCCACTACTCTGAATGAATATCGATTGATTGAAAAAGATGTGGCTCTTGCCCGA
CGGTTCCAGCCTATTCTGGTGAGTGAGCCGTCGGTCGCCTCGACTATTTCCATTCTACGGGGCATCAAGAACAAA
TACGAAGTACATCATGGTGTCAGAATTACAGATGGCGCTTTAGTAGCTGCAGCCACTTACAGTAATCGCTACATC
ACCGATCGATTCCTGCCCGACAAAGCGATTGATCTTGTCGATGAAGCTGCATCGGCTCTTCGCTTGCAACAGGAG
TCGAAACCCGACTCGATTCGGGAACTTGAACGTGACATTACTACCATCCAAATTGAGCTTGAGTCTCTTCGCAAG
GAAACCGATGTTGCCAGCCGCGAACGGCGAGAGAAGCTTCAAGAAGACCTGAAGACCAAGCAAGCGGAGGCCAGT
AAATTGACCGAGGCCTGGGAAGAGGAGAAGGCCGAAATTGATACCATCAAACGCACCAAGGAGAATTTAGAACGC
GCTCGGTTTGAACTTGAACAAGCTCAACGCGAAGGAAACTTTGCCAAGGCTGGAGAATTGAGATACTCTACCATC
CCAGAGCTCGAAGCCAAGCTACCCAAAGAAGGCGCTGAACAGGATCCTCATAATCAAACTCTGATTCACGACTCA
GTTACTGCAGATGACATTGGAAACGTCGTTTCTCGGACCACAGGCATCCCCGTTAACAAGCTCATGGCTGGAGAC
GTGGAGAAGTTGATTCATATGGAGGACACTCTCCGAAAATCAGTCCGCGGACAAGATGAAGCGCTTTCTGCTGTG
GCAAATGCTGTGCGGATGCAGAGAGCTGGTCTCAGCGGAGAAAATCGCCCTATGGCCTCTTTCATGTTCCTTGGT
CCCACCGGTGTTGGAAAGACTGAGCTCTGCAAGAAGATGGCCGAGTTCCTTTTCTCCACGGAAACTGCAGTTTTA
CGGTTTGACATGAGTGAATTCCAGGAGAAGCACACAATCAGTCGACTCATTGGTTCTCCTGCCGGATATGTTGGA
TATGATGATGCTGGTCAGCTCACCGAGGCTGTCAGACGGAAGCCTTACGCTGTTCTGCTATTTGATGAATTCGAG
AAGGCTCATCGTGATATCTCAGCGCTCCTGCTGCAGGTCCTCGATGAGGGCTTCCTGACAGATGCGCAAGGCCAC
AAGGTTGATTTCCGAAACACCCTGATTGTGTTGACCTCGAATCTTGGAGCTAGTATCCTGGTCGGAGCAGACCCC
TTGTACCCAATTAAAGATGACGCCGGTGATGCCGAGCTCCCAGAAAAGGTCAAATCGGCTGTTATGGATGTGGTT
CAGAGCGCATACCCACCTGAGTTCATGAACCGAATCGATGAATTCATCATCTTCAGACGCCTGTCCCAGGATGCT
CTCCGGGACATCGTCGATATCAGAATCAAAGAGCTTCAGGCTAGACTCGATGACCGCCGTATGACTCTGCAGGTT
GACAATGAGACTAAGGACTGGCTGTGCGAGAAAGGCTACGACCCCAAATTTGGTGCCCGGCCTTTGAACCGTCTC
ATTGCTAAGGAGATTGGAAACCGCTTGGCTGATAAGATCATCCGAGGTGAAATTGTCTCTGGTCAAACTGCCCGA
GTTTCTCTTGATGAGTCTAAGTCTGGCCTTGTGGTAACTGCGGAGACCGCGGAAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail