Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7815.t1
Gene name
Locationscaffold_26:169043..170986
Strand+
Gene length (bp)1943
Transcript length (bp)1884
Coding sequence length (bp)1884
Protein length (aa) 628

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09368 Sas10 Sas10 C-terminal domain 6.8E-28 553 627
PF04000 Sas10_Utp3 Sas10/Utp3/C1D family 2.0E-13 208 305

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 31.87 18.67 45.07
5d_25C Five days - 25 degrees Celsius 24.32 13.64 35.00
7d_25C Seven days - 25 degrees Celsius 24.42 13.71 35.13
10d_25C Ten days - 25 degrees Celsius 18.80 9.90 27.70
7d_15C Seven days - 15 degrees Celsius 29.40 16.80 42.00
7d_30C Seven days - 30 degrees Celsius 24.71 13.89 35.52

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.280529 no
3d_25C 7d_25C 0.296862 no
3d_25C 7d_15C 0.802720 no
3d_25C 7d_30C 0.320482 no
3d_25C 10d_25C 0.024657 yes
5d_25C 7d_25C 0.992023 no
5d_25C 7d_15C 0.506128 no
5d_25C 7d_30C 0.967761 no
5d_25C 10d_25C 0.361205 no
7d_25C 7d_15C 0.515766 no
7d_25C 7d_30C 0.976344 no
7d_25C 10d_25C 0.352333 no
7d_15C 7d_30C 0.549645 no
7d_15C 10d_25C 0.069866 no
7d_30C 10d_25C 0.325238 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7815.t1
MGSKKRKAGRPAENKAPEPSKFDIEERFDDSEDDFQTGRDQILLEEGPEAKRRRRVAEEEELIQPSDEEILGYES
IDEDDDLEDSEEDDEYDDMGQPKKGDAESEEDEEGIAAWGSSKKDLYNADQIETEVDALEEEQEAKRLQMKQLQA
MNEADFGFDESEWVESGKGTEDGADAGVVTEVLPQLEITDDMDTDEKLKILKSRYPEFEPLAKDFVDLQSSFKDL
QQAALKASSTDDDSEEPQPSPVPVVKFRALSAYLGTISMYFMLLSSPSPDATSEHVPMTPAELRQHPVMGSLVKF
RKLWNTVKDLEELEEPVGEPIKETKTEKTKTEKQPKTQEIKKPKQKKLSKAEIAQAEAEALRAERLRQTEAGLAD
LENLATEPSRKRKTQKIKAPLKDDDSDFGDEDALTAHEAEEKAKQKRSLRFYTSQLAQKANKRNAAGRDAGGDAD
LPYRERLRDRQARLNVEAEKRGRKELNPDQQLGGDSDDEDRRVAKELRRGEGAKEGTDDDEYYDMVASRSKKRKD
DKQARADAYAEAERLGGKIFVQEEVGPDGKRAITYQIQKNKGLHAKRSKDSRNPRVKKRKKYEEKKKKLGSTKQL
YKGGEGRGGYGGELTGIKKNLVKSVKL*
Coding >Pro_DTO377G3_2|g7815.t1
ATGGGCAGCAAAAAGAGAAAAGCTGGTCGTCCAGCGGAGAACAAAGCTCCTGAGCCCTCTAAGTTTGACATCGAA
GAGCGATTCGACGACTCGGAAGATGACTTCCAAACCGGCCGCGACCAGATTCTACTCGAGGAAGGCCCAGAGGCG
AAGAGACGGCGCAGAGTTGCCGAGGAGGAGGAATTGATCCAGCCTTCAGACGAAGAAATCCTTGGCTACGAATCC
ATAGACGAGGATGACGATCTCGAAGACTCAGAAGAAGACGACGAATATGATGATATGGGTCAGCCAAAGAAGGGT
GATGCAGAATCCGAGGAAGATGAAGAAGGCATTGCTGCCTGGGGTTCATCGAAAAAGGATCTTTATAACGCAGAT
CAGATCGAGACCGAGGTTGATGCATTGGAGGAAGAGCAGGAGGCCAAGCGACTACAAATGAAGCAGTTGCAGGCT
ATGAATGAGGCCGATTTCGGGTTTGACGAGTCTGAATGGGTGGAATCCGGCAAGGGTACCGAGGACGGCGCCGAC
GCTGGCGTGGTAACTGAAGTGCTTCCACAATTGGAGATCACTGATGATATGGACACCGATGAGAAGCTGAAAATT
TTGAAGTCGAGATACCCCGAGTTTGAACCCCTAGCGAAGGACTTCGTGGACCTTCAAAGCTCCTTCAAAGATCTT
CAACAAGCAGCCTTGAAGGCTTCCTCAACAGACGACGACTCAGAGGAGCCACAGCCATCCCCAGTGCCTGTGGTG
AAATTCCGTGCGTTGTCTGCATACCTTGGCACGATCAGCATGTATTTCATGCTCCTTTCCTCCCCATCTCCCGAC
GCGACTAGCGAGCATGTTCCGATGACCCCTGCCGAACTCCGACAACACCCTGTCATGGGATCGCTTGTCAAATTC
CGGAAGCTTTGGAACACTGTCAAGGATCTCGAGGAGCTTGAGGAACCCGTTGGGGAGCCTATCAAGGAGACTAAG
ACCGAGAAAACCAAGACCGAGAAGCAACCAAAGACCCAAGAGATCAAGAAGCCGAAACAGAAGAAGCTCAGCAAG
GCCGAGATAGCACAGGCAGAAGCCGAAGCTCTTCGCGCCGAGCGTCTCCGCCAAACAGAAGCTGGCCTCGCCGAT
CTCGAGAATTTGGCCACCGAGCCTTCACGGAAGCGCAAGACACAAAAGATCAAGGCACCTCTCAAGGATGATGAC
TCTGACTTCGGTGATGAGGATGCCCTCACAGCCCATGAGGCAGAAGAGAAGGCCAAGCAGAAGCGCTCGCTCCGT
TTCTACACCTCGCAACTGGCCCAGAAAGCCAACAAACGTAACGCAGCAGGCCGAGATGCTGGTGGAGACGCCGAT
CTCCCATACCGCGAACGTCTGCGTGACCGTCAAGCCCGTCTCAATGTGGAAGCCGAGAAGCGCGGCCGCAAAGAA
CTCAACCCCGACCAGCAGCTGGGCGGTGACAGTGACGACGAGGATCGTCGCGTCGCCAAGGAGCTCCGCCGCGGT
GAGGGTGCCAAGGAGGGCACTGATGACGATGAATACTACGACATGGTGGCATCTCGCTCCAAGAAGCGCAAGGAC
GACAAGCAGGCTCGTGCAGATGCCTACGCTGAGGCTGAGCGCCTTGGTGGAAAAATCTTTGTGCAAGAGGAGGTT
GGTCCAGATGGCAAGCGTGCAATCACGTATCAGATCCAGAAGAACAAGGGTCTGCACGCGAAACGCAGTAAAGAC
TCGCGTAACCCGCGTGTTAAGAAGAGAAAGAAGTACGAGGAAAAGAAGAAGAAGCTTGGCAGTACTAAGCAACTG
TACAAGGGCGGCGAGGGCCGCGGTGGATATGGTGGTGAGCTTACGGGTATCAAGAAAAACCTGGTCAAGAGTGTT
AAGCTGTGA
Transcript >Pro_DTO377G3_2|g7815.t1
ATGGGCAGCAAAAAGAGAAAAGCTGGTCGTCCAGCGGAGAACAAAGCTCCTGAGCCCTCTAAGTTTGACATCGAA
GAGCGATTCGACGACTCGGAAGATGACTTCCAAACCGGCCGCGACCAGATTCTACTCGAGGAAGGCCCAGAGGCG
AAGAGACGGCGCAGAGTTGCCGAGGAGGAGGAATTGATCCAGCCTTCAGACGAAGAAATCCTTGGCTACGAATCC
ATAGACGAGGATGACGATCTCGAAGACTCAGAAGAAGACGACGAATATGATGATATGGGTCAGCCAAAGAAGGGT
GATGCAGAATCCGAGGAAGATGAAGAAGGCATTGCTGCCTGGGGTTCATCGAAAAAGGATCTTTATAACGCAGAT
CAGATCGAGACCGAGGTTGATGCATTGGAGGAAGAGCAGGAGGCCAAGCGACTACAAATGAAGCAGTTGCAGGCT
ATGAATGAGGCCGATTTCGGGTTTGACGAGTCTGAATGGGTGGAATCCGGCAAGGGTACCGAGGACGGCGCCGAC
GCTGGCGTGGTAACTGAAGTGCTTCCACAATTGGAGATCACTGATGATATGGACACCGATGAGAAGCTGAAAATT
TTGAAGTCGAGATACCCCGAGTTTGAACCCCTAGCGAAGGACTTCGTGGACCTTCAAAGCTCCTTCAAAGATCTT
CAACAAGCAGCCTTGAAGGCTTCCTCAACAGACGACGACTCAGAGGAGCCACAGCCATCCCCAGTGCCTGTGGTG
AAATTCCGTGCGTTGTCTGCATACCTTGGCACGATCAGCATGTATTTCATGCTCCTTTCCTCCCCATCTCCCGAC
GCGACTAGCGAGCATGTTCCGATGACCCCTGCCGAACTCCGACAACACCCTGTCATGGGATCGCTTGTCAAATTC
CGGAAGCTTTGGAACACTGTCAAGGATCTCGAGGAGCTTGAGGAACCCGTTGGGGAGCCTATCAAGGAGACTAAG
ACCGAGAAAACCAAGACCGAGAAGCAACCAAAGACCCAAGAGATCAAGAAGCCGAAACAGAAGAAGCTCAGCAAG
GCCGAGATAGCACAGGCAGAAGCCGAAGCTCTTCGCGCCGAGCGTCTCCGCCAAACAGAAGCTGGCCTCGCCGAT
CTCGAGAATTTGGCCACCGAGCCTTCACGGAAGCGCAAGACACAAAAGATCAAGGCACCTCTCAAGGATGATGAC
TCTGACTTCGGTGATGAGGATGCCCTCACAGCCCATGAGGCAGAAGAGAAGGCCAAGCAGAAGCGCTCGCTCCGT
TTCTACACCTCGCAACTGGCCCAGAAAGCCAACAAACGTAACGCAGCAGGCCGAGATGCTGGTGGAGACGCCGAT
CTCCCATACCGCGAACGTCTGCGTGACCGTCAAGCCCGTCTCAATGTGGAAGCCGAGAAGCGCGGCCGCAAAGAA
CTCAACCCCGACCAGCAGCTGGGCGGTGACAGTGACGACGAGGATCGTCGCGTCGCCAAGGAGCTCCGCCGCGGT
GAGGGTGCCAAGGAGGGCACTGATGACGATGAATACTACGACATGGTGGCATCTCGCTCCAAGAAGCGCAAGGAC
GACAAGCAGGCTCGTGCAGATGCCTACGCTGAGGCTGAGCGCCTTGGTGGAAAAATCTTTGTGCAAGAGGAGGTT
GGTCCAGATGGCAAGCGTGCAATCACGTATCAGATCCAGAAGAACAAGGGTCTGCACGCGAAACGCAGTAAAGAC
TCGCGTAACCCGCGTGTTAAGAAGAGAAAGAAGTACGAGGAAAAGAAGAAGAAGCTTGGCAGTACTAAGCAACTG
TACAAGGGCGGCGAGGGCCGCGGTGGATATGGTGGTGAGCTTACGGGTATCAAGAAAAACCTGGTCAAGAGTGTT
AAGCTGTGA
Gene >Pro_DTO377G3_2|g7815.t1
ATGGGCAGCAAAAAGAGAAAAGCTGGTCGTCCAGCGGAGAACAAAGCTCCTGAGCCCTCTAAGTTTGACATCGAA
GAGCGATTCGACGACTCGGAAGATGACTTCCAAACCGGCCGCGACCAGATTCTACTCGAGGAAGGCCCAGAGGCG
AAGAGACGGCGCAGAGTTGCCGAGGAGGGTATGTGCCTTTGAGGATAAACTGAGCTTGTGCGAACGGTGTCTTAC
TGATTGTCACAGAGGAATTGATCCAGCCTTCAGACGAAGAAATCCTTGGCTACGAATCCATAGACGAGGATGACG
ATCTCGAAGACTCAGAAGAAGACGACGAATATGATGATATGGGTCAGCCAAAGAAGGGTGATGCAGAATCCGAGG
AAGATGAAGAAGGCATTGCTGCCTGGGGTTCATCGAAAAAGGATCTTTATAACGCAGATCAGATCGAGACCGAGG
TTGATGCATTGGAGGAAGAGCAGGAGGCCAAGCGACTACAAATGAAGCAGTTGCAGGCTATGAATGAGGCCGATT
TCGGGTTTGACGAGTCTGAATGGGTGGAATCCGGCAAGGGTACCGAGGACGGCGCCGACGCTGGCGTGGTAACTG
AAGTGCTTCCACAATTGGAGATCACTGATGATATGGACACCGATGAGAAGCTGAAAATTTTGAAGTCGAGATACC
CCGAGTTTGAACCCCTAGCGAAGGACTTCGTGGACCTTCAAAGCTCCTTCAAAGATCTTCAACAAGCAGCCTTGA
AGGCTTCCTCAACAGACGACGACTCAGAGGAGCCACAGCCATCCCCAGTGCCTGTGGTGAAATTCCGTGCGTTGT
CTGCATACCTTGGCACGATCAGCATGTATTTCATGCTCCTTTCCTCCCCATCTCCCGACGCGACTAGCGAGCATG
TTCCGATGACCCCTGCCGAACTCCGACAACACCCTGTCATGGGATCGCTTGTCAAATTCCGGAAGCTTTGGAACA
CTGTCAAGGATCTCGAGGAGCTTGAGGAACCCGTTGGGGAGCCTATCAAGGAGACTAAGACCGAGAAAACCAAGA
CCGAGAAGCAACCAAAGACCCAAGAGATCAAGAAGCCGAAACAGAAGAAGCTCAGCAAGGCCGAGATAGCACAGG
CAGAAGCCGAAGCTCTTCGCGCCGAGCGTCTCCGCCAAACAGAAGCTGGCCTCGCCGATCTCGAGAATTTGGCCA
CCGAGCCTTCACGGAAGCGCAAGACACAAAAGATCAAGGCACCTCTCAAGGATGATGACTCTGACTTCGGTGATG
AGGATGCCCTCACAGCCCATGAGGCAGAAGAGAAGGCCAAGCAGAAGCGCTCGCTCCGTTTCTACACCTCGCAAC
TGGCCCAGAAAGCCAACAAACGTAACGCAGCAGGCCGAGATGCTGGTGGAGACGCCGATCTCCCATACCGCGAAC
GTCTGCGTGACCGTCAAGCCCGTCTCAATGTGGAAGCCGAGAAGCGCGGCCGCAAAGAACTCAACCCCGACCAGC
AGCTGGGCGGTGACAGTGACGACGAGGATCGTCGCGTCGCCAAGGAGCTCCGCCGCGGTGAGGGTGCCAAGGAGG
GCACTGATGACGATGAATACTACGACATGGTGGCATCTCGCTCCAAGAAGCGCAAGGACGACAAGCAGGCTCGTG
CAGATGCCTACGCTGAGGCTGAGCGCCTTGGTGGAAAAATCTTTGTGCAAGAGGAGGTTGGTCCAGATGGCAAGC
GTGCAATCACGTATCAGATCCAGAAGAACAAGGGTCTGCACGCGAAACGCAGTAAAGACTCGCGTAACCCGCGTG
TTAAGAAGAGAAAGAAGTACGAGGAAAAGAAGAAGAAGCTTGGCAGTACTAAGCAACTGTACAAGGGCGGCGAGG
GCCGCGGTGGATATGGTGGTGAGCTTACGGGTATCAAGAAAAACCTGGTCAAGAGTGTTAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail