Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g781.t1
Gene name
Locationscaffold_01:2091351..2094093
Strand-
Gene length (bp)2742
Transcript length (bp)2742
Coding sequence length (bp)2742
Protein length (aa) 914

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 7.1E-47 109 274
PF00271 Helicase_C Helicase conserved C-terminal domain 1.9E-23 361 460
PF08147 DBP10CT DBP10CT (NUC160) domain 2.8E-21 745 809

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004004 ATP-dependent RNA helicase activity Yes
GO:0005634 nucleus Yes
GO:0016462 pyrophosphatase activity No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0043226 organelle No
GO:0017111 nucleoside-triphosphatase activity No
GO:0043168 anion binding No
GO:0004386 helicase activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0032553 ribonucleotide binding No
GO:0043229 intracellular organelle No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0070035 purine NTP-dependent helicase activity No
GO:1901363 heterocyclic compound binding No
GO:0043227 membrane-bounded organelle No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0016887 ATPase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0042623 ATPase activity, coupled No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0008144 drug binding No
GO:0016787 hydrolase activity No
GO:0008026 ATP-dependent helicase activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0008186 RNA-dependent ATPase activity No
GO:0003724 RNA helicase activity No
GO:0005575 cellular_component No
GO:0030554 adenyl nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g781.t1
MAPRAASPAESEVEFDITKSLFEHDSDSDDGAKPPPKKKPQKPDTHQDLDFLNEDDGDAAFIANSQASANRKGAN
LKGRTVKKGGGFQAMGLSMSLLKAITRKGFSVPTPIQRKTIPMIMDDKDVVGMARTGSGKTASFVIPMIEKLKSH
STSFGARALIMSPSRELALQTMKVVKEMGKGTNLTSVLLIGGDSLEDQFGMMANNPDIIIATPGRFLHLKVEMDM
DLSSIKYVVFDEADRLFEMGFAAQLTEILHGLPTNRQTLLFSATLPKSLVEFARAGLQEPSLIRLDIENKVSPDL
QNAFFAVKSADKEGALLHILHNIIKMPTGETYIGGRLRQEAENPTRKRKRSDVRLPSGFKESPTEHSTIVFAATK
HHVDYLYSLLTEAGFATSYAYGSLDQTARNHHVQNFRSGISNILVVTDVAARGIDIPVLANVINYDFPSQPKIFI
HRVGRTARAGQKGWSYSLVRDKDAPYLLDLQLFLGRRLVLGRQYGTEVNFAEDVVVGTLPREAISRTCEWVQKVL
DDDIDIYGQKGVSQKGEKLYLRTRNSASAESAKRAKDVVSSDHWAEIHPLFNDATTEREVERESMLARIGGYRPH
ETIFEANNRRGGKVADNEAVDTIRRLRTSVENKRKRADAKAEAELAALGMPTPGPDGQVEDEDIPEHAGENMSDA
SDDDLEVTFSAYNSKSKQGEKKDAAAAFQNPDYFMGYTPQHNDMAEDKAYGVHSGTNSNFASDSRNATMDLNGDE
GKRGFGEARSIMRWDKRHKKYVARQNDEDGSKGSRLVRGESGAKIAASFRSGRFQAWKKGKRVDRMPRVGEAETP
NMNNVNSRMSSGRFRHSQDRAPKRADPLRGDYDKMKKKNDAARERQHDKLGGAAYGGKSELRSTEDIRKARKQVQ
QRRDKNARPSKRR*
Coding >Pro_DTO377G3_2|g781.t1
ATGGCTCCCCGTGCTGCCTCACCCGCAGAATCGGAGGTCGAGTTCGACATCACAAAATCCCTTTTTGAACATGAC
AGCGATTCCGATGACGGCGCAAAGCCACCCCCCAAGAAAAAGCCCCAGAAGCCCGATACCCACCAAGATCTTGAC
TTTTTAAACGAAGACGACGGCGATGCGGCTTTCATTGCGAACTCGCAGGCGTCCGCCAACCGAAAGGGCGCAAAT
CTCAAGGGCCGTACGGTGAAGAAGGGTGGTGGTTTCCAGGCAATGGGTCTCAGCATGAGTCTGCTGAAAGCGATC
ACCCGCAAAGGATTTTCCGTGCCTACCCCGATTCAGCGAAAGACTATTCCCATGATCATGGACGACAAGGATGTG
GTTGGTATGGCTCGAACTGGTTCCGGAAAGACTGCCTCGTTTGTTATTCCTATGATTGAGAAGTTGAAGAGCCAT
AGCACCTCGTTCGGTGCACGTGCTCTTATCATGTCCCCATCCCGTGAATTGGCTCTACAAACCATGAAGGTCGTT
AAGGAGATGGGCAAGGGAACAAATTTGACATCGGTGCTTCTCATTGGTGGTGACAGTCTGGAAGATCAGTTCGGC
ATGATGGCCAACAACCCCGATATCATCATCGCAACACCCGGTCGATTCCTGCACTTGAAGGTCGAAATGGACATG
GATCTTTCTAGCATCAAGTATGTTGTCTTCGATGAAGCCGACAGACTGTTCGAAATGGGTTTCGCCGCACAGTTG
ACCGAGATTTTGCACGGCCTGCCCACGAACCGCCAGACTCTTCTCTTTTCCGCTACATTGCCCAAGTCGCTTGTC
GAATTTGCTCGTGCTGGTCTCCAAGAGCCAAGTCTAATTCGTCTGGACATCGAGAACAAAGTTTCTCCGGATCTA
CAAAATGCCTTCTTTGCTGTGAAGTCGGCAGATAAAGAAGGTGCCCTACTACATATTTTGCATAACATTATCAAG
ATGCCTACCGGTGAGACATATATTGGCGGGAGATTACGCCAAGAAGCCGAGAACCCGACAAGGAAGCGCAAGAGA
TCGGATGTCCGTCTCCCGAGCGGCTTCAAGGAGTCACCTACCGAGCACTCAACTATTGTGTTCGCTGCAACCAAG
CATCACGTCGACTACCTCTACTCTCTTCTCACCGAGGCAGGGTTTGCCACCTCTTACGCCTACGGTTCCCTGGAT
CAGACTGCTCGTAATCACCATGTTCAAAACTTCCGATCCGGAATCTCAAATATCCTAGTCGTCACCGATGTGGCC
GCCAGAGGTATTGATATTCCTGTTCTTGCCAACGTCATCAACTACGATTTCCCCTCACAGCCCAAGATCTTCATT
CACCGTGTCGGTCGTACGGCTCGTGCAGGCCAAAAGGGTTGGAGTTACAGTCTTGTTCGCGACAAAGATGCCCCG
TATCTTCTGGATCTTCAGCTGTTCTTGGGACGCAGGTTGGTCCTCGGTCGTCAGTATGGCACTGAAGTCAACTTT
GCAGAGGATGTTGTCGTGGGAACGCTGCCGAGAGAGGCAATCTCTCGCACTTGCGAATGGGTACAGAAGGTGCTC
GACGATGATATAGATATTTACGGACAAAAGGGAGTGTCTCAAAAGGGAGAGAAGCTATATCTGCGCACCCGCAAC
TCGGCTTCTGCCGAGAGTGCCAAACGGGCCAAGGATGTTGTGTCTTCTGATCACTGGGCTGAGATTCACCCGCTC
TTCAATGATGCAACCACTGAGAGGGAAGTAGAGCGAGAGAGTATGCTGGCCCGCATTGGTGGTTACCGCCCACAT
GAAACGATTTTCGAGGCGAACAACCGACGAGGCGGCAAAGTGGCTGACAACGAGGCCGTTGACACCATTCGCCGA
CTCCGCACTAGTGTCGAGAACAAGAGAAAGCGAGCGGATGCCAAAGCAGAGGCCGAGTTGGCAGCGCTTGGAATG
CCCACTCCCGGCCCGGATGGTCAAGTGGAGGACGAGGACATCCCCGAGCATGCCGGCGAGAACATGTCAGACGCA
TCCGACGATGACCTCGAAGTCACTTTCTCTGCGTACAACTCCAAGTCCAAGCAAGGCGAGAAAAAAGACGCAGCA
GCAGCATTCCAGAACCCGGATTATTTCATGGGCTACACACCTCAGCACAACGACATGGCCGAAGATAAGGCTTAC
GGTGTGCACTCGGGTACCAACTCGAACTTTGCCAGCGACTCCCGCAACGCGACTATGGACCTCAACGGCGACGAA
GGCAAGCGCGGGTTCGGCGAAGCGCGTTCCATCATGCGCTGGGACAAGCGACACAAGAAGTACGTTGCCCGCCAG
AACGACGAGGACGGTTCCAAGGGCAGCCGACTCGTGCGCGGCGAGAGTGGAGCCAAGATCGCCGCCAGTTTCCGC
AGCGGTCGCTTCCAGGCCTGGAAGAAGGGCAAGCGCGTTGATCGGATGCCTCGTGTTGGCGAGGCCGAGACGCCT
AATATGAACAACGTCAACTCGCGCATGAGCAGTGGCCGATTCCGACACAGCCAGGACCGGGCGCCTAAGCGGGCC
GATCCTCTGCGTGGCGACTACGACAAGATGAAGAAGAAGAACGACGCGGCGCGCGAACGCCAGCACGATAAGCTT
GGTGGAGCGGCATACGGCGGAAAGAGCGAACTTCGGTCTACGGAGGATATTCGCAAGGCGCGGAAGCAGGTGCAA
CAGCGTCGCGATAAGAATGCCCGGCCGTCGAAGAGACGCTAG
Transcript >Pro_DTO377G3_2|g781.t1
ATGGCTCCCCGTGCTGCCTCACCCGCAGAATCGGAGGTCGAGTTCGACATCACAAAATCCCTTTTTGAACATGAC
AGCGATTCCGATGACGGCGCAAAGCCACCCCCCAAGAAAAAGCCCCAGAAGCCCGATACCCACCAAGATCTTGAC
TTTTTAAACGAAGACGACGGCGATGCGGCTTTCATTGCGAACTCGCAGGCGTCCGCCAACCGAAAGGGCGCAAAT
CTCAAGGGCCGTACGGTGAAGAAGGGTGGTGGTTTCCAGGCAATGGGTCTCAGCATGAGTCTGCTGAAAGCGATC
ACCCGCAAAGGATTTTCCGTGCCTACCCCGATTCAGCGAAAGACTATTCCCATGATCATGGACGACAAGGATGTG
GTTGGTATGGCTCGAACTGGTTCCGGAAAGACTGCCTCGTTTGTTATTCCTATGATTGAGAAGTTGAAGAGCCAT
AGCACCTCGTTCGGTGCACGTGCTCTTATCATGTCCCCATCCCGTGAATTGGCTCTACAAACCATGAAGGTCGTT
AAGGAGATGGGCAAGGGAACAAATTTGACATCGGTGCTTCTCATTGGTGGTGACAGTCTGGAAGATCAGTTCGGC
ATGATGGCCAACAACCCCGATATCATCATCGCAACACCCGGTCGATTCCTGCACTTGAAGGTCGAAATGGACATG
GATCTTTCTAGCATCAAGTATGTTGTCTTCGATGAAGCCGACAGACTGTTCGAAATGGGTTTCGCCGCACAGTTG
ACCGAGATTTTGCACGGCCTGCCCACGAACCGCCAGACTCTTCTCTTTTCCGCTACATTGCCCAAGTCGCTTGTC
GAATTTGCTCGTGCTGGTCTCCAAGAGCCAAGTCTAATTCGTCTGGACATCGAGAACAAAGTTTCTCCGGATCTA
CAAAATGCCTTCTTTGCTGTGAAGTCGGCAGATAAAGAAGGTGCCCTACTACATATTTTGCATAACATTATCAAG
ATGCCTACCGGTGAGACATATATTGGCGGGAGATTACGCCAAGAAGCCGAGAACCCGACAAGGAAGCGCAAGAGA
TCGGATGTCCGTCTCCCGAGCGGCTTCAAGGAGTCACCTACCGAGCACTCAACTATTGTGTTCGCTGCAACCAAG
CATCACGTCGACTACCTCTACTCTCTTCTCACCGAGGCAGGGTTTGCCACCTCTTACGCCTACGGTTCCCTGGAT
CAGACTGCTCGTAATCACCATGTTCAAAACTTCCGATCCGGAATCTCAAATATCCTAGTCGTCACCGATGTGGCC
GCCAGAGGTATTGATATTCCTGTTCTTGCCAACGTCATCAACTACGATTTCCCCTCACAGCCCAAGATCTTCATT
CACCGTGTCGGTCGTACGGCTCGTGCAGGCCAAAAGGGTTGGAGTTACAGTCTTGTTCGCGACAAAGATGCCCCG
TATCTTCTGGATCTTCAGCTGTTCTTGGGACGCAGGTTGGTCCTCGGTCGTCAGTATGGCACTGAAGTCAACTTT
GCAGAGGATGTTGTCGTGGGAACGCTGCCGAGAGAGGCAATCTCTCGCACTTGCGAATGGGTACAGAAGGTGCTC
GACGATGATATAGATATTTACGGACAAAAGGGAGTGTCTCAAAAGGGAGAGAAGCTATATCTGCGCACCCGCAAC
TCGGCTTCTGCCGAGAGTGCCAAACGGGCCAAGGATGTTGTGTCTTCTGATCACTGGGCTGAGATTCACCCGCTC
TTCAATGATGCAACCACTGAGAGGGAAGTAGAGCGAGAGAGTATGCTGGCCCGCATTGGTGGTTACCGCCCACAT
GAAACGATTTTCGAGGCGAACAACCGACGAGGCGGCAAAGTGGCTGACAACGAGGCCGTTGACACCATTCGCCGA
CTCCGCACTAGTGTCGAGAACAAGAGAAAGCGAGCGGATGCCAAAGCAGAGGCCGAGTTGGCAGCGCTTGGAATG
CCCACTCCCGGCCCGGATGGTCAAGTGGAGGACGAGGACATCCCCGAGCATGCCGGCGAGAACATGTCAGACGCA
TCCGACGATGACCTCGAAGTCACTTTCTCTGCGTACAACTCCAAGTCCAAGCAAGGCGAGAAAAAAGACGCAGCA
GCAGCATTCCAGAACCCGGATTATTTCATGGGCTACACACCTCAGCACAACGACATGGCCGAAGATAAGGCTTAC
GGTGTGCACTCGGGTACCAACTCGAACTTTGCCAGCGACTCCCGCAACGCGACTATGGACCTCAACGGCGACGAA
GGCAAGCGCGGGTTCGGCGAAGCGCGTTCCATCATGCGCTGGGACAAGCGACACAAGAAGTACGTTGCCCGCCAG
AACGACGAGGACGGTTCCAAGGGCAGCCGACTCGTGCGCGGCGAGAGTGGAGCCAAGATCGCCGCCAGTTTCCGC
AGCGGTCGCTTCCAGGCCTGGAAGAAGGGCAAGCGCGTTGATCGGATGCCTCGTGTTGGCGAGGCCGAGACGCCT
AATATGAACAACGTCAACTCGCGCATGAGCAGTGGCCGATTCCGACACAGCCAGGACCGGGCGCCTAAGCGGGCC
GATCCTCTGCGTGGCGACTACGACAAGATGAAGAAGAAGAACGACGCGGCGCGCGAACGCCAGCACGATAAGCTT
GGTGGAGCGGCATACGGCGGAAAGAGCGAACTTCGGTCTACGGAGGATATTCGCAAGGCGCGGAAGCAGGTGCAA
CAGCGTCGCGATAAGAATGCCCGGCCGTCGAAGAGACGCTAG
Gene >Pro_DTO377G3_2|g781.t1
ATGGCTCCCCGTGCTGCCTCACCCGCAGAATCGGAGGTCGAGTTCGACATCACAAAATCCCTTTTTGAACATGAC
AGCGATTCCGATGACGGCGCAAAGCCACCCCCCAAGAAAAAGCCCCAGAAGCCCGATACCCACCAAGATCTTGAC
TTTTTAAACGAAGACGACGGCGATGCGGCTTTCATTGCGAACTCGCAGGCGTCCGCCAACCGAAAGGGCGCAAAT
CTCAAGGGCCGTACGGTGAAGAAGGGTGGTGGTTTCCAGGCAATGGGTCTCAGCATGAGTCTGCTGAAAGCGATC
ACCCGCAAAGGATTTTCCGTGCCTACCCCGATTCAGCGAAAGACTATTCCCATGATCATGGACGACAAGGATGTG
GTTGGTATGGCTCGAACTGGTTCCGGAAAGACTGCCTCGTTTGTTATTCCTATGATTGAGAAGTTGAAGAGCCAT
AGCACCTCGTTCGGTGCACGTGCTCTTATCATGTCCCCATCCCGTGAATTGGCTCTACAAACCATGAAGGTCGTT
AAGGAGATGGGCAAGGGAACAAATTTGACATCGGTGCTTCTCATTGGTGGTGACAGTCTGGAAGATCAGTTCGGC
ATGATGGCCAACAACCCCGATATCATCATCGCAACACCCGGTCGATTCCTGCACTTGAAGGTCGAAATGGACATG
GATCTTTCTAGCATCAAGTATGTTGTCTTCGATGAAGCCGACAGACTGTTCGAAATGGGTTTCGCCGCACAGTTG
ACCGAGATTTTGCACGGCCTGCCCACGAACCGCCAGACTCTTCTCTTTTCCGCTACATTGCCCAAGTCGCTTGTC
GAATTTGCTCGTGCTGGTCTCCAAGAGCCAAGTCTAATTCGTCTGGACATCGAGAACAAAGTTTCTCCGGATCTA
CAAAATGCCTTCTTTGCTGTGAAGTCGGCAGATAAAGAAGGTGCCCTACTACATATTTTGCATAACATTATCAAG
ATGCCTACCGGTGAGACATATATTGGCGGGAGATTACGCCAAGAAGCCGAGAACCCGACAAGGAAGCGCAAGAGA
TCGGATGTCCGTCTCCCGAGCGGCTTCAAGGAGTCACCTACCGAGCACTCAACTATTGTGTTCGCTGCAACCAAG
CATCACGTCGACTACCTCTACTCTCTTCTCACCGAGGCAGGGTTTGCCACCTCTTACGCCTACGGTTCCCTGGAT
CAGACTGCTCGTAATCACCATGTTCAAAACTTCCGATCCGGAATCTCAAATATCCTAGTCGTCACCGATGTGGCC
GCCAGAGGTATTGATATTCCTGTTCTTGCCAACGTCATCAACTACGATTTCCCCTCACAGCCCAAGATCTTCATT
CACCGTGTCGGTCGTACGGCTCGTGCAGGCCAAAAGGGTTGGAGTTACAGTCTTGTTCGCGACAAAGATGCCCCG
TATCTTCTGGATCTTCAGCTGTTCTTGGGACGCAGGTTGGTCCTCGGTCGTCAGTATGGCACTGAAGTCAACTTT
GCAGAGGATGTTGTCGTGGGAACGCTGCCGAGAGAGGCAATCTCTCGCACTTGCGAATGGGTACAGAAGGTGCTC
GACGATGATATAGATATTTACGGACAAAAGGGAGTGTCTCAAAAGGGAGAGAAGCTATATCTGCGCACCCGCAAC
TCGGCTTCTGCCGAGAGTGCCAAACGGGCCAAGGATGTTGTGTCTTCTGATCACTGGGCTGAGATTCACCCGCTC
TTCAATGATGCAACCACTGAGAGGGAAGTAGAGCGAGAGAGTATGCTGGCCCGCATTGGTGGTTACCGCCCACAT
GAAACGATTTTCGAGGCGAACAACCGACGAGGCGGCAAAGTGGCTGACAACGAGGCCGTTGACACCATTCGCCGA
CTCCGCACTAGTGTCGAGAACAAGAGAAAGCGAGCGGATGCCAAAGCAGAGGCCGAGTTGGCAGCGCTTGGAATG
CCCACTCCCGGCCCGGATGGTCAAGTGGAGGACGAGGACATCCCCGAGCATGCCGGCGAGAACATGTCAGACGCA
TCCGACGATGACCTCGAAGTCACTTTCTCTGCGTACAACTCCAAGTCCAAGCAAGGCGAGAAAAAAGACGCAGCA
GCAGCATTCCAGAACCCGGATTATTTCATGGGCTACACACCTCAGCACAACGACATGGCCGAAGATAAGGCTTAC
GGTGTGCACTCGGGTACCAACTCGAACTTTGCCAGCGACTCCCGCAACGCGACTATGGACCTCAACGGCGACGAA
GGCAAGCGCGGGTTCGGCGAAGCGCGTTCCATCATGCGCTGGGACAAGCGACACAAGAAGTACGTTGCCCGCCAG
AACGACGAGGACGGTTCCAAGGGCAGCCGACTCGTGCGCGGCGAGAGTGGAGCCAAGATCGCCGCCAGTTTCCGC
AGCGGTCGCTTCCAGGCCTGGAAGAAGGGCAAGCGCGTTGATCGGATGCCTCGTGTTGGCGAGGCCGAGACGCCT
AATATGAACAACGTCAACTCGCGCATGAGCAGTGGCCGATTCCGACACAGCCAGGACCGGGCGCCTAAGCGGGCC
GATCCTCTGCGTGGCGACTACGACAAGATGAAGAAGAAGAACGACGCGGCGCGCGAACGCCAGCACGATAAGCTT
GGTGGAGCGGCATACGGCGGAAAGAGCGAACTTCGGTCTACGGAGGATATTCGCAAGGCGCGGAAGCAGGTGCAA
CAGCGTCGCGATAAGAATGCCCGGCCGTCGAAGAGACGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail