Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7806.t1
Gene name
Locationscaffold_26:139427..142757
Strand+
Gene length (bp)3330
Transcript length (bp)2331
Coding sequence length (bp)2331
Protein length (aa) 777

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 2.3E-180 78 734

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22
2 107 126 19
3 154 176 22
4 186 208 22
5 264 286 22
6 296 318 22
7 330 352 22
8 402 424 22
9 457 479 22
10 484 506 22
11 513 535 22
12 567 589 22
13 601 623 22
14 633 655 22
15 676 698 22
16 713 735 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7806.t1
MPNDKKSVTNTIQELHKVQLSHQWDPNLPQEKIDAINEAVKTDDQERALELEKTLAHESQYESVRAAVRNSDGGE
VANTVRAWVLGMFFTTLGSGLNMFLSMRSPAISFPAIVVQLLVYPIGCLWAKTMPTRKFNTFGVKWTLNTGPFTI
KEHAVITIMANVSIGYAYCTDALLALKAKPLYNMELGWGFQLLFALSSQVIGMSLAGIFRRFLVWPAAMMWPSQF
ANTSLFYALHDWSSSDESETHGWSISRYRYFLYVTIGSFIWYWVPGVLWQGLSVFAFVTWIRPNNVVLNQLFGGF
TGLSLIPITFDWTYVSAYLGDPLLAPVHALVNTFIGLVVFVIITTIGISYSGALYSAYLPINTSSTYDNTQSAYN
VTRILGSGFSFDEEKYKAYSPMFLAPTFALNYGLSFAALTAAIVHVILFHRKEIWHQFRASRNQEPDIHLIMMKK
YKEAPDWWYATLFLCSIALGLAGILAYDSQLPWWGFFVSIIIAVVFIIPTCVILGITNIMLSLNVLSPFLAGFMI
PGKPIAVMVFKVFSTITLGQAQVYCSDLKLAHYMKVPPRVTFMCQVVATVWASIVQIAVMNWTLNNIDEVCTTTQ
SGNFTCPNGRAFFSSSIVWGVIGPRRMFGPGGMYMQIQWFWLIGALLPVVFYVLIRMRPRSKLRFLNAPVMLGAM
AWLPPATPLSFSSWVIFGLIFNYWIRRRWGGWWHTYNYITAAGLDSGLILSTIVIFFAIILPNVSIPQWWGNIAP
YETMDSLYTAVRKTVADGETFGPKEW*
Coding >Pro_DTO377G3_2|g7806.t1
ATGCCAAACGATAAGAAGTCAGTAACCAATACGATCCAAGAGTTACACAAGGTCCAACTCTCCCACCAGTGGGAT
CCAAATTTGCCACAGGAGAAGATTGATGCTATCAACGAGGCAGTCAAGACAGATGATCAAGAGAGGGCCCTCGAG
TTAGAAAAGACTCTCGCCCATGAGTCCCAGTATGAGTCTGTTCGTGCCGCGGTGCGCAACTCAGATGGCGGAGAA
GTTGCCAACACCGTGCGCGCGTGGGTGCTGGGCATGTTCTTCACTACTCTTGGAAGTGGTCTCAATATGTTTCTG
AGCATGAGGAGCCCTGCCATCTCGTTCCCTGCTATTGTCGTTCAGTTGCTGGTCTATCCGATAGGTTGTTTGTGG
GCCAAGACAATGCCGACTCGGAAGTTCAATACATTTGGAGTGAAATGGACGTTGAATACTGGTCCGTTCACTATC
AAAGAGCATGCGGTTATCACAATCATGGCAAATGTGTCGATCGGCTATGCTTATTGTACAGATGCCCTCTTGGCA
TTGAAAGCGAAGCCACTATATAATATGGAACTTGGATGGGGTTTCCAACTATTATTCGCTTTGAGCAGTCAGGTA
ATTGGTATGTCCCTGGCAGGCATTTTCCGCCGTTTCCTCGTCTGGCCCGCTGCTATGATGTGGCCTAGTCAATTT
GCGAACACTTCCCTGTTTTATGCTCTTCACGACTGGAGCTCCTCGGATGAATCAGAGACCCACGGATGGAGCATT
TCACGCTACCGATATTTTCTATATGTGACAATTGGGTCTTTTATCTGGTATTGGGTACCGGGAGTCCTATGGCAA
GGACTCTCTGTGTTTGCTTTTGTCACATGGATCCGACCCAACAATGTGGTTTTGAACCAGTTGTTCGGAGGCTTC
ACAGGACTCTCCCTCATTCCTATCACGTTTGATTGGACCTATGTTTCTGCATATCTCGGAGATCCACTCTTGGCA
CCTGTCCATGCTCTTGTCAACACCTTCATCGGGCTTGTGGTTTTTGTAATCATCACCACAATCGGGATCTCTTAC
TCTGGGGCTTTGTACTCCGCCTATCTCCCTATCAACACGTCTAGCACCTATGACAACACGCAAAGCGCCTATAAT
GTGACCAGAATCCTAGGTTCTGGTTTCTCTTTTGATGAGGAAAAATACAAGGCATATTCGCCGATGTTCCTAGCT
CCGACATTTGCCTTGAACTACGGATTGTCGTTTGCGGCCCTTACAGCAGCTATTGTACATGTTATTCTCTTCCAT
CGAAAGGAGATATGGCATCAATTCAGGGCTTCTCGGAATCAGGAACCCGACATTCATCTTATCATGATGAAAAAG
TACAAAGAAGCCCCCGACTGGTGGTATGCGACACTATTCCTATGCTCGATCGCACTAGGGCTTGCAGGCATTCTG
GCATATGATTCGCAGCTCCCTTGGTGGGGCTTTTTTGTCTCAATTATCATTGCCGTCGTCTTTATAATTCCGACT
TGCGTGATCCTCGGCATCACCAATATTATGCTTTCGCTCAATGTCTTATCGCCTTTTCTGGCAGGTTTCATGATT
CCAGGAAAGCCGATTGCGGTCATGGTATTCAAGGTCTTTAGCACCATCACCTTGGGACAAGCTCAAGTATACTGT
TCGGATCTCAAACTGGCCCATTATATGAAAGTGCCACCCCGCGTCACCTTTATGTGTCAAGTTGTTGCAACGGTA
TGGGCAAGTATTGTTCAGATTGCAGTCATGAACTGGACCCTGAACAATATCGATGAAGTTTGCACAACTACTCAG
TCGGGGAATTTTACATGCCCGAATGGAAGAGCATTCTTTTCATCCAGCATTGTGTGGGGTGTCATTGGTCCACGA
CGTATGTTTGGACCTGGCGGCATGTACATGCAAATACAATGGTTCTGGTTGATTGGTGCTCTTCTTCCGGTGGTA
TTCTATGTCTTGATAAGAATGCGCCCTCGGTCTAAGCTCAGGTTCCTAAACGCACCTGTGATGCTAGGTGCTATG
GCCTGGCTGCCTCCGGCCACCCCATTGAGCTTCTCTTCATGGGTTATCTTTGGCCTCATATTCAACTACTGGATT
CGACGCCGATGGGGCGGTTGGTGGCATACTTACAACTATATCACCGCCGCAGGACTTGACTCGGGCCTCATTCTG
TCCACCATTGTTATTTTCTTTGCGATTATTCTGCCAAATGTCTCGATACCCCAATGGTGGGGAAATATTGCTCCA
TACGAGACCATGGACTCTCTTTATACGGCAGTTCGAAAGACTGTCGCAGATGGAGAGACTTTCGGACCAAAAGAG
TGGTGA
Transcript >Pro_DTO377G3_2|g7806.t1
ATGCCAAACGATAAGAAGTCAGTAACCAATACGATCCAAGAGTTACACAAGGTCCAACTCTCCCACCAGTGGGAT
CCAAATTTGCCACAGGAGAAGATTGATGCTATCAACGAGGCAGTCAAGACAGATGATCAAGAGAGGGCCCTCGAG
TTAGAAAAGACTCTCGCCCATGAGTCCCAGTATGAGTCTGTTCGTGCCGCGGTGCGCAACTCAGATGGCGGAGAA
GTTGCCAACACCGTGCGCGCGTGGGTGCTGGGCATGTTCTTCACTACTCTTGGAAGTGGTCTCAATATGTTTCTG
AGCATGAGGAGCCCTGCCATCTCGTTCCCTGCTATTGTCGTTCAGTTGCTGGTCTATCCGATAGGTTGTTTGTGG
GCCAAGACAATGCCGACTCGGAAGTTCAATACATTTGGAGTGAAATGGACGTTGAATACTGGTCCGTTCACTATC
AAAGAGCATGCGGTTATCACAATCATGGCAAATGTGTCGATCGGCTATGCTTATTGTACAGATGCCCTCTTGGCA
TTGAAAGCGAAGCCACTATATAATATGGAACTTGGATGGGGTTTCCAACTATTATTCGCTTTGAGCAGTCAGGTA
ATTGGTATGTCCCTGGCAGGCATTTTCCGCCGTTTCCTCGTCTGGCCCGCTGCTATGATGTGGCCTAGTCAATTT
GCGAACACTTCCCTGTTTTATGCTCTTCACGACTGGAGCTCCTCGGATGAATCAGAGACCCACGGATGGAGCATT
TCACGCTACCGATATTTTCTATATGTGACAATTGGGTCTTTTATCTGGTATTGGGTACCGGGAGTCCTATGGCAA
GGACTCTCTGTGTTTGCTTTTGTCACATGGATCCGACCCAACAATGTGGTTTTGAACCAGTTGTTCGGAGGCTTC
ACAGGACTCTCCCTCATTCCTATCACGTTTGATTGGACCTATGTTTCTGCATATCTCGGAGATCCACTCTTGGCA
CCTGTCCATGCTCTTGTCAACACCTTCATCGGGCTTGTGGTTTTTGTAATCATCACCACAATCGGGATCTCTTAC
TCTGGGGCTTTGTACTCCGCCTATCTCCCTATCAACACGTCTAGCACCTATGACAACACGCAAAGCGCCTATAAT
GTGACCAGAATCCTAGGTTCTGGTTTCTCTTTTGATGAGGAAAAATACAAGGCATATTCGCCGATGTTCCTAGCT
CCGACATTTGCCTTGAACTACGGATTGTCGTTTGCGGCCCTTACAGCAGCTATTGTACATGTTATTCTCTTCCAT
CGAAAGGAGATATGGCATCAATTCAGGGCTTCTCGGAATCAGGAACCCGACATTCATCTTATCATGATGAAAAAG
TACAAAGAAGCCCCCGACTGGTGGTATGCGACACTATTCCTATGCTCGATCGCACTAGGGCTTGCAGGCATTCTG
GCATATGATTCGCAGCTCCCTTGGTGGGGCTTTTTTGTCTCAATTATCATTGCCGTCGTCTTTATAATTCCGACT
TGCGTGATCCTCGGCATCACCAATATTATGCTTTCGCTCAATGTCTTATCGCCTTTTCTGGCAGGTTTCATGATT
CCAGGAAAGCCGATTGCGGTCATGGTATTCAAGGTCTTTAGCACCATCACCTTGGGACAAGCTCAAGTATACTGT
TCGGATCTCAAACTGGCCCATTATATGAAAGTGCCACCCCGCGTCACCTTTATGTGTCAAGTTGTTGCAACGGTA
TGGGCAAGTATTGTTCAGATTGCAGTCATGAACTGGACCCTGAACAATATCGATGAAGTTTGCACAACTACTCAG
TCGGGGAATTTTACATGCCCGAATGGAAGAGCATTCTTTTCATCCAGCATTGTGTGGGGTGTCATTGGTCCACGA
CGTATGTTTGGACCTGGCGGCATGTACATGCAAATACAATGGTTCTGGTTGATTGGTGCTCTTCTTCCGGTGGTA
TTCTATGTCTTGATAAGAATGCGCCCTCGGTCTAAGCTCAGGTTCCTAAACGCACCTGTGATGCTAGGTGCTATG
GCCTGGCTGCCTCCGGCCACCCCATTGAGCTTCTCTTCATGGGTTATCTTTGGCCTCATATTCAACTACTGGATT
CGACGCCGATGGGGCGGTTGGTGGCATACTTACAACTATATCACCGCCGCAGGACTTGACTCGGGCCTCATTCTG
TCCACCATTGTTATTTTCTTTGCGATTATTCTGCCAAATGTCTCGATACCCCAATGGTGGGGAAATATTGCTCCA
TACGAGACCATGGACTCTCTTTATACGGCAGTTCGAAAGACTGTCGCAGATGGAGAGACTTTCGGACCAAAAGAG
TGGTGA
Gene >Pro_DTO377G3_2|g7806.t1
ATGCCAAACGATAAGAAGTCAGTAACCAATACGATCCAAGAGTTACACAAGGTCCAACTCTCCCACCAGTGGGAT
CCAAATTTGCCACAGGAGAAGATTGATGCTATCAACGAGGCAGTCAAGACAGATGATCAAGAGAGGGCCCTCGAG
TTAGAAAAGACTCTCGCCCATGAGTCCCAGTATGAGTCTGTTCGTGCCGCGGTGCGCAACTCAGATGGCGGAGAA
GTTGCCAACACCGTGCGCGCGTGGGTGCTGGGCATGTTCTTCACTACTCTTGGAAGTGGTCTCAATATGTTTCTG
AGCATGAGGTGAGATTTGGTTCTGCGGTCTATAAGTAGGGGATAATTTACTCATCGTGTATTAGGAGCCCTGCCA
TCTCGTTCCCTGCTATTGTCGTTCAGTTGCTGGTCTATCCGATAGGTTGTTTGTGGGCCAAGACAATGCCGACTC
GGAAGTTCAATACATTTGGAGTGAAATGGACGTTGAATACTGGTCCGTTCACTATCAAAGAGCATGCGGTTATCA
CAGTAAGCTCTTGAAAGTTGGTGTTCAAATCAATTAAGCTGACCTTTTGTTCTCAGATCATGGCAAAGTCGGTAG
TTCTTGATAAACTTTGATATCAATGCTAAGCAATATATAGTGTGTCGATCGGCTATGCTTATTGTACAGATGCCC
TCTTGGCATTGAAAGCGAAGCGTAAGCAACATCTCTGCGTCAATTCAATATTGTCTAACGCACTTTCCAGCACTA
TATAATATGGAACTTGGATGGGGTTTCCAACTATTATTCGCTTTGAGCAGTCAGGTAATTGGTATGTCCCTGGCA
GGCATTTTCCGCCGTTTCCTCGTCTGGTAAGTTGGAACCTTTCCTGCCAAGAGCCCCAAAAACTCACGATGTCAA
GGCCCGCTGCTATGATGTGGCCTAGTCAATTTGCGAACACTTCCCTGTTTTATGCTCTTCACGACTGGAGCTCCT
CGGATGAATCAGAGACCCACGGATGGAGCATTTCACGCTACCGATATTTTCTATATGTGACAATTGGGTCTTTTA
TCTGGTATTGGTAAGTCTATCTTGTTCTAATTTGAACTGCATATACTGATTTCTTCGAACTGCAGGGTACCGGGA
GTCCTATGGCAAGGACTCTCTGTGTTTGCTTTTGTCACATGTAAGATCCCGTTGACTCGTTTCATTCCTGACTTG
CGGTGACTCTTTTTGCCTGTAGGGATCCGACCCAACAATGTGGTTTTGAACCAGTTGTTCGGAGGCTTCACAGGA
CTCTCCCTCATTCCTATCACGTTTGATTGGACGTAAGATTCCCGTCAATGGTATACATGCTGGAAAGATGTAAAG
CTAATTACAACCAGCTATGTTTCTGCATATCTCGGAGATCCACTCTTGGCACCTGTCCATGCTCTTGTCAACACC
TTCATCGGGCTTGTGGTTTTTGTAATCATCACCACAATCGGGATCTCTTACTCTGGGGCTTTGTATGCTGAAACA
TCTCACCACAATCATTTCAAAGCTGACACAATATAGGTACTCCGCCTATCTCCCTATCAACACGTCTAGCACCTA
TGACAACACGCAAAGCGCCTATAATGTGACCAGAATCCTAGGTTCTGGTTTCTCTTTTGATGAGGAAAAATACAA
GGCATATTCGCCGATGTTCCTAGCTCCGACATTTGCCTTGAACTACGGATTGTCGTTTGCGGCCCTTACAGCAGC
TATTGTACATGTTATTCTCTTCCATCGAAAGGAGATATGGCATCAATTCAGGGCTTCTCGGAATCAGGAACCCGA
CATTCATCTTATCATGATGAAAAAGTACAAAGAAGCCCCCGACTGGTGGTATGCGACACTATTCCTATGCTCGAT
CGCACTAGGGCTTGCAGGCATTCTGGCATATGATTCGCAGCTCCCTTGTATGCAATACTCCTCGAGATCTGATGA
TCAAATCTAATCAAACATAGGGTGGGGCTTTTTTGTCTCAATTATCATTGCCGTCGTCTTTATAGTACGTTTTGT
CATGGCCACTGGAAGGTTCTTTCTGACTCATCCAACAGATTCCGACTTGCGTGATCCTCGGCATCACCAATATTA
TGCTTTGTACGTGCGGTCTCGACCTTTTTGTGGGTGCAACGCTAATTTATATAGCGCTCAATGTCTTATCGCCTT
TTCTGGCAGGTTTCATGATTCCAGGAAAGCCGATTGCGGTCATGGTATTCAAGGTCTTTAGCACCATCACCTTGG
GACAAGCGTAAGGTTCAATCCTCTCTTCCCAGAATAGTGACTGACCTTGTCAATAGTCAAGTATACTGTTCGGAT
CTCAAAGTAAGGGACTTCCTCTCCATGTCAGTGGACCAAATTGTTGACTTTTCTTCAACAACAGCTGGCCCATTA
TATGAAAGTGCCACCCCGCGTCACCTTTATGTGTCAAGTTGTTGCAACGGTATGGGCAAGTATTGTTCAGATTGC
AGTCATGAACTGGACCCTGAACAATATCGATGAAGTTTGCACAACGTATGTTATGCACATCTTTGAAAGAGAACA
TGTATTAACCATCTATGAAAATAGTACTCAGTCGGGGAATTTTACATGCCCGAATGGAAGAGCATTCTTTTCATC
CAGCATTGTGTGGGGTCAGTTTGTTCTATCTCAGGGATGTATCAACATATTACTGACTTCTTATTTAGGTGTCAT
TGGTCCACGACGTATGTTTGGACCTGGCGGCATGTACATGCAAATACAATGGTTCTGGTTGATTGGTGCTCTTCT
TCCGGTGGTATTCTATGTCTTGATAAGAATGCGCCCTCGGTCTAAGCTCAGGTTCCTAAACGCACCTGTGTAAGT
CGCGGAAGCTCATCTTTGGTGAAATGTGCTAATTGTATCAATAGGATGCTAGGTGCTATGGCCTGGCTGCCTCCG
TAAGTCTACAACACTCCCGATGCTATTGTTCACGGTTGCCTCTTACTGATCATTTCACAGGGCCACCCCATTGAG
CTTCTCTTCATGGGTTATCTTTGGCCTCATATTCAACTACTGGATTCGACGCCGATGGGGCGGTTGGTGGCATAC
TTACAACTATATCACCGCCGCAGGACTTGACTCGGGCCTCATTCTGTCCACCATTGTTATTTTCTTTGCGATTAT
TCTGCCAAATGTCTCGATACCCCAATGGTGGGGAAATATTGCTCCATACGAGACCATGGTACGTAACTATATCCC
GCCATTTATTGACGTGGGTCCTAACGAGGAACATAGGACTCTCTTTATACGGCAGTTCGAAAGACTGTCGCAGAT
GGAGAGACTTTCGGACCAAAAGAGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail