Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7803.t1
Gene name
Locationscaffold_26:129985..132902
Strand-
Gene length (bp)2917
Transcript length (bp)2868
Coding sequence length (bp)2868
Protein length (aa) 956

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 8.3E-78 387 670
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.0E-42 34 187
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.6E-40 210 376

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 120 137 17
3 163 185 22
4 391 413 22
5 438 460 22
6 480 502 22
7 551 573 22
8 594 616 22
9 620 639 19
10 651 670 19
11 675 697 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7803.t1
MDLQQLGLHARTDGTDTFLELIANPFRSAFTVTAIWASLGTSIGVTVLLALLFSLVRPRHSLVYAPKVKHADLKH
TPPPVGKGFFAWVKPVINTREPQLIESVGLDAAIFLRFTKMCRNIFIFLSIIGCLVMIPVNITQSKNSTDSTASA
AFNMMTPLNITNPMAIWSQVVCAWAFDLIVAFFLWRNYRAVRNLRRTYFQSAEYQRSLHARTLMITDIPVNSRTD
EGILRLTDKVNPTSALPRAAIGRNVRDLPRLIKEHEEVVRELESVLAKYLKNPDRLPAKRPTLHPPRRQRKQFPG
GKVDAIDYLSVRIRVLEEEIKHGRASIDRRNAMPYGFASWDNIEHAHAVAWNARRKRPEGTTIALAPRPSDIIWE
NLPLSKSARKWKRLINFIWVTGLTLVWIVPNGLIAIFLSNLSNLGLVWPAFQTSLAMNPNVWAAVQGIASPALTS
LVYLALPVIFRRLSIQGGSKTKTSRERHVLGHLYAFFVFNNLIVFSLFSAAWYFVSFVVDKTKNHEDAWQAILES
RMYAKLVSALCTVSPFWVTYLLQRNLGAAIDLVQFVTMAWVWFAKTFLSPTPRQAIEWTAPPSFDYASYYNYFLF
YATVAFCFATLQPIVLPVTALYFGVDAMLKKYLLMYVFVTKNESGGAFWRVLFNRMIFATILANVIIALVAKSSG
TWNMVFCVIPLPFLMIGFKIYCMKTFDSDCEFVNRANLSDAEALGVNTSDKKASDRLNTKFGHPALYKPLLTPMV
HAKAAAALKEIYQGRLDQGDMGGEYSDIAMNPMLASQPGKSAEPAPFEVVPENHLDFSYYKDRADFRDEFGGGIY
GRPDDLMTERSHTPRSTLRGEWSPGSSRASSPAPSLPSMPLNMHKGYEHEHSDPTGLIHPAFRVPLSRGNSGRSA
ANADESESGLLSNAQAPGQTDITNPLGRWRTGGYGPVDQEDEPSYTSYDAYRSHG*
Coding >Pro_DTO377G3_2|g7803.t1
ATGGATCTACAACAATTGGGCTTGCATGCCCGCACGGATGGGACAGATACCTTCCTTGAGCTCATTGCAAATCCA
TTTCGGTCTGCATTTACAGTCACTGCTATTTGGGCCTCGCTAGGCACCTCGATCGGCGTCACCGTCCTCCTCGCT
CTCCTCTTCTCCCTAGTTCGACCCCGTCACTCGCTTGTCTATGCGCCCAAAGTCAAGCATGCAGACCTCAAACAC
ACCCCGCCGCCGGTGGGCAAGGGCTTCTTCGCCTGGGTCAAGCCGGTGATCAATACACGGGAACCGCAGCTGATC
GAGTCAGTCGGGCTGGACGCCGCAATCTTCCTCCGCTTTACAAAAATGTGCCGCAACATCTTCATCTTTCTCAGT
ATAATCGGCTGCCTCGTCATGATACCGGTCAATATTACACAGAGCAAGAATTCTACTGACTCGACGGCGTCTGCC
GCCTTCAACATGATGACGCCCCTCAACATCACCAACCCCATGGCCATTTGGAGTCAAGTGGTATGCGCCTGGGCT
TTTGATCTTATTGTTGCTTTCTTCTTATGGAGGAACTATCGCGCTGTGCGGAACCTGCGGAGGACATATTTCCAA
AGCGCTGAATACCAGCGCAGTCTGCATGCCAGAACCTTGATGATCACGGACATCCCTGTCAATAGTCGTACCGAT
GAAGGTATTCTGCGGCTAACCGACAAGGTCAATCCCACCTCGGCCCTCCCACGAGCTGCTATTGGCCGCAATGTC
AGGGATTTGCCTCGCCTCATCAAGGAACATGAAGAGGTTGTCCGAGAACTCGAGTCCGTTTTGGCCAAGTATCTT
AAGAACCCGGACCGATTGCCAGCGAAACGACCGACCCTACATCCCCCTCGCCGACAACGCAAACAATTCCCCGGC
GGCAAAGTGGACGCGATAGATTATCTATCCGTGCGGATTCGCGTCTTGGAAGAGGAAATCAAGCATGGCCGGGCA
TCGATTGATCGCCGAAACGCGATGCCGTACGGCTTTGCCAGCTGGGACAATATCGAGCACGCGCATGCTGTGGCA
TGGAACGCTCGCCGCAAACGCCCTGAGGGCACTACTATTGCTCTTGCGCCGCGGCCCAGCGATATCATATGGGAA
AACCTTCCGCTTTCAAAATCCGCGCGCAAGTGGAAGCGACTGATCAATTTTATCTGGGTGACAGGCTTGACACTG
GTGTGGATTGTTCCTAACGGTTTGATTGCCATTTTCTTGTCCAATCTGTCCAATCTGGGCTTGGTATGGCCGGCG
TTCCAGACTTCGCTGGCAATGAACCCAAACGTTTGGGCTGCTGTCCAGGGTATTGCATCGCCCGCACTAACTTCG
CTCGTGTATCTGGCGCTTCCGGTGATCTTCCGTCGACTTTCTATCCAAGGTGGTAGCAAGACTAAAACATCTCGA
GAGCGCCACGTGCTGGGGCATCTGTATGCATTCTTCGTTTTCAACAATCTGATCGTCTTCTCACTTTTCTCGGCT
GCTTGGTACTTCGTGTCGTTCGTGGTTGACAAAACCAAAAACCACGAAGACGCTTGGCAAGCCATCTTGGAAAGC
CGGATGTATGCCAAATTGGTAAGCGCTCTCTGCACCGTGTCACCGTTCTGGGTGACGTATCTTTTGCAGCGTAAT
CTCGGCGCTGCTATTGATCTGGTGCAGTTCGTTACCATGGCTTGGGTCTGGTTCGCCAAGACGTTCCTCTCACCC
ACACCCCGACAGGCAATTGAGTGGACCGCACCGCCATCATTCGACTACGCCAGTTACTACAACTACTTCCTCTTC
TATGCCACCGTGGCTTTCTGTTTCGCTACCTTGCAACCCATCGTACTGCCGGTGACAGCATTGTATTTTGGTGTG
GATGCCATGTTGAAGAAGTATCTATTGATGTACGTGTTCGTGACTAAGAATGAGTCTGGTGGTGCGTTTTGGCGT
GTGTTATTCAATCGCATGATCTTCGCTACTATTCTTGCGAACGTGATCATCGCTCTCGTGGCCAAATCGAGCGGC
ACGTGGAACATGGTGTTCTGCGTGATTCCCCTGCCTTTCTTGATGATTGGATTCAAGATCTATTGCATGAAGACG
TTTGACTCCGATTGCGAGTTTGTAAACCGTGCAAATCTAAGCGATGCCGAGGCCTTAGGTGTGAACACCTCAGAC
AAGAAAGCGTCAGACCGTCTGAATACCAAGTTCGGACACCCTGCCCTGTACAAACCACTTTTGACACCCATGGTG
CACGCCAAGGCAGCCGCAGCACTAAAAGAAATCTACCAAGGTCGTCTGGACCAGGGTGACATGGGCGGCGAGTAC
TCAGACATTGCAATGAACCCGATGCTGGCCTCCCAGCCCGGCAAGTCTGCCGAACCCGCGCCCTTCGAGGTCGTC
CCGGAGAACCATCTAGACTTCTCCTACTACAAGGATCGAGCAGACTTCCGAGACGAGTTCGGAGGCGGCATCTAC
GGCCGGCCTGATGACCTGATGACAGAGCGGTCACATACACCCCGCAGTACTTTGCGAGGCGAGTGGTCTCCCGGC
TCATCTCGTGCCTCATCACCCGCACCCTCTCTGCCATCAATGCCGCTGAACATGCACAAGGGTTACGAACACGAA
CACTCCGACCCGACCGGGCTTATCCACCCGGCCTTCCGTGTGCCGCTATCGCGGGGCAACAGTGGCAGGTCGGCT
GCAAACGCAGACGAGTCGGAGTCCGGACTCCTCAGCAATGCACAGGCTCCTGGGCAGACGGATATCACGAATCCG
CTCGGTCGCTGGAGGACCGGTGGTTATGGACCAGTCGACCAGGAAGACGAGCCCTCGTATACTTCTTACGACGCT
TACCGTTCACATGGGTAA
Transcript >Pro_DTO377G3_2|g7803.t1
ATGGATCTACAACAATTGGGCTTGCATGCCCGCACGGATGGGACAGATACCTTCCTTGAGCTCATTGCAAATCCA
TTTCGGTCTGCATTTACAGTCACTGCTATTTGGGCCTCGCTAGGCACCTCGATCGGCGTCACCGTCCTCCTCGCT
CTCCTCTTCTCCCTAGTTCGACCCCGTCACTCGCTTGTCTATGCGCCCAAAGTCAAGCATGCAGACCTCAAACAC
ACCCCGCCGCCGGTGGGCAAGGGCTTCTTCGCCTGGGTCAAGCCGGTGATCAATACACGGGAACCGCAGCTGATC
GAGTCAGTCGGGCTGGACGCCGCAATCTTCCTCCGCTTTACAAAAATGTGCCGCAACATCTTCATCTTTCTCAGT
ATAATCGGCTGCCTCGTCATGATACCGGTCAATATTACACAGAGCAAGAATTCTACTGACTCGACGGCGTCTGCC
GCCTTCAACATGATGACGCCCCTCAACATCACCAACCCCATGGCCATTTGGAGTCAAGTGGTATGCGCCTGGGCT
TTTGATCTTATTGTTGCTTTCTTCTTATGGAGGAACTATCGCGCTGTGCGGAACCTGCGGAGGACATATTTCCAA
AGCGCTGAATACCAGCGCAGTCTGCATGCCAGAACCTTGATGATCACGGACATCCCTGTCAATAGTCGTACCGAT
GAAGGTATTCTGCGGCTAACCGACAAGGTCAATCCCACCTCGGCCCTCCCACGAGCTGCTATTGGCCGCAATGTC
AGGGATTTGCCTCGCCTCATCAAGGAACATGAAGAGGTTGTCCGAGAACTCGAGTCCGTTTTGGCCAAGTATCTT
AAGAACCCGGACCGATTGCCAGCGAAACGACCGACCCTACATCCCCCTCGCCGACAACGCAAACAATTCCCCGGC
GGCAAAGTGGACGCGATAGATTATCTATCCGTGCGGATTCGCGTCTTGGAAGAGGAAATCAAGCATGGCCGGGCA
TCGATTGATCGCCGAAACGCGATGCCGTACGGCTTTGCCAGCTGGGACAATATCGAGCACGCGCATGCTGTGGCA
TGGAACGCTCGCCGCAAACGCCCTGAGGGCACTACTATTGCTCTTGCGCCGCGGCCCAGCGATATCATATGGGAA
AACCTTCCGCTTTCAAAATCCGCGCGCAAGTGGAAGCGACTGATCAATTTTATCTGGGTGACAGGCTTGACACTG
GTGTGGATTGTTCCTAACGGTTTGATTGCCATTTTCTTGTCCAATCTGTCCAATCTGGGCTTGGTATGGCCGGCG
TTCCAGACTTCGCTGGCAATGAACCCAAACGTTTGGGCTGCTGTCCAGGGTATTGCATCGCCCGCACTAACTTCG
CTCGTGTATCTGGCGCTTCCGGTGATCTTCCGTCGACTTTCTATCCAAGGTGGTAGCAAGACTAAAACATCTCGA
GAGCGCCACGTGCTGGGGCATCTGTATGCATTCTTCGTTTTCAACAATCTGATCGTCTTCTCACTTTTCTCGGCT
GCTTGGTACTTCGTGTCGTTCGTGGTTGACAAAACCAAAAACCACGAAGACGCTTGGCAAGCCATCTTGGAAAGC
CGGATGTATGCCAAATTGGTAAGCGCTCTCTGCACCGTGTCACCGTTCTGGGTGACGTATCTTTTGCAGCGTAAT
CTCGGCGCTGCTATTGATCTGGTGCAGTTCGTTACCATGGCTTGGGTCTGGTTCGCCAAGACGTTCCTCTCACCC
ACACCCCGACAGGCAATTGAGTGGACCGCACCGCCATCATTCGACTACGCCAGTTACTACAACTACTTCCTCTTC
TATGCCACCGTGGCTTTCTGTTTCGCTACCTTGCAACCCATCGTACTGCCGGTGACAGCATTGTATTTTGGTGTG
GATGCCATGTTGAAGAAGTATCTATTGATGTACGTGTTCGTGACTAAGAATGAGTCTGGTGGTGCGTTTTGGCGT
GTGTTATTCAATCGCATGATCTTCGCTACTATTCTTGCGAACGTGATCATCGCTCTCGTGGCCAAATCGAGCGGC
ACGTGGAACATGGTGTTCTGCGTGATTCCCCTGCCTTTCTTGATGATTGGATTCAAGATCTATTGCATGAAGACG
TTTGACTCCGATTGCGAGTTTGTAAACCGTGCAAATCTAAGCGATGCCGAGGCCTTAGGTGTGAACACCTCAGAC
AAGAAAGCGTCAGACCGTCTGAATACCAAGTTCGGACACCCTGCCCTGTACAAACCACTTTTGACACCCATGGTG
CACGCCAAGGCAGCCGCAGCACTAAAAGAAATCTACCAAGGTCGTCTGGACCAGGGTGACATGGGCGGCGAGTAC
TCAGACATTGCAATGAACCCGATGCTGGCCTCCCAGCCCGGCAAGTCTGCCGAACCCGCGCCCTTCGAGGTCGTC
CCGGAGAACCATCTAGACTTCTCCTACTACAAGGATCGAGCAGACTTCCGAGACGAGTTCGGAGGCGGCATCTAC
GGCCGGCCTGATGACCTGATGACAGAGCGGTCACATACACCCCGCAGTACTTTGCGAGGCGAGTGGTCTCCCGGC
TCATCTCGTGCCTCATCACCCGCACCCTCTCTGCCATCAATGCCGCTGAACATGCACAAGGGTTACGAACACGAA
CACTCCGACCCGACCGGGCTTATCCACCCGGCCTTCCGTGTGCCGCTATCGCGGGGCAACAGTGGCAGGTCGGCT
GCAAACGCAGACGAGTCGGAGTCCGGACTCCTCAGCAATGCACAGGCTCCTGGGCAGACGGATATCACGAATCCG
CTCGGTCGCTGGAGGACCGGTGGTTATGGACCAGTCGACCAGGAAGACGAGCCCTCGTATACTTCTTACGACGCT
TACCGTTCACATGGGTAA
Gene >Pro_DTO377G3_2|g7803.t1
ATGGATCTACAACAATTGGGCTTGCATGCCCGCACGGATGGGACAGATACCTTCCTTGAGCTCATTGCAAATCCA
TTTCGGTCTGCAGTAAGTCGAAATTGTTTGCGAGGAGGAACACCACATTGACAAGCTATAGTTTACAGTCACTGC
TATTTGGGCCTCGCTAGGCACCTCGATCGGCGTCACCGTCCTCCTCGCTCTCCTCTTCTCCCTAGTTCGACCCCG
TCACTCGCTTGTCTATGCGCCCAAAGTCAAGCATGCAGACCTCAAACACACCCCGCCGCCGGTGGGCAAGGGCTT
CTTCGCCTGGGTCAAGCCGGTGATCAATACACGGGAACCGCAGCTGATCGAGTCAGTCGGGCTGGACGCCGCAAT
CTTCCTCCGCTTTACAAAAATGTGCCGCAACATCTTCATCTTTCTCAGTATAATCGGCTGCCTCGTCATGATACC
GGTCAATATTACACAGAGCAAGAATTCTACTGACTCGACGGCGTCTGCCGCCTTCAACATGATGACGCCCCTCAA
CATCACCAACCCCATGGCCATTTGGAGTCAAGTGGTATGCGCCTGGGCTTTTGATCTTATTGTTGCTTTCTTCTT
ATGGAGGAACTATCGCGCTGTGCGGAACCTGCGGAGGACATATTTCCAAAGCGCTGAATACCAGCGCAGTCTGCA
TGCCAGAACCTTGATGATCACGGACATCCCTGTCAATAGTCGTACCGATGAAGGTATTCTGCGGCTAACCGACAA
GGTCAATCCCACCTCGGCCCTCCCACGAGCTGCTATTGGCCGCAATGTCAGGGATTTGCCTCGCCTCATCAAGGA
ACATGAAGAGGTTGTCCGAGAACTCGAGTCCGTTTTGGCCAAGTATCTTAAGAACCCGGACCGATTGCCAGCGAA
ACGACCGACCCTACATCCCCCTCGCCGACAACGCAAACAATTCCCCGGCGGCAAAGTGGACGCGATAGATTATCT
ATCCGTGCGGATTCGCGTCTTGGAAGAGGAAATCAAGCATGGCCGGGCATCGATTGATCGCCGAAACGCGATGCC
GTACGGCTTTGCCAGCTGGGACAATATCGAGCACGCGCATGCTGTGGCATGGAACGCTCGCCGCAAACGCCCTGA
GGGCACTACTATTGCTCTTGCGCCGCGGCCCAGCGATATCATATGGGAAAACCTTCCGCTTTCAAAATCCGCGCG
CAAGTGGAAGCGACTGATCAATTTTATCTGGGTGACAGGCTTGACACTGGTGTGGATTGTTCCTAACGGTTTGAT
TGCCATTTTCTTGTCCAATCTGTCCAATCTGGGCTTGGTATGGCCGGCGTTCCAGACTTCGCTGGCAATGAACCC
AAACGTTTGGGCTGCTGTCCAGGGTATTGCATCGCCCGCACTAACTTCGCTCGTGTATCTGGCGCTTCCGGTGAT
CTTCCGTCGACTTTCTATCCAAGGTGGTAGCAAGACTAAAACATCTCGAGAGCGCCACGTGCTGGGGCATCTGTA
TGCATTCTTCGTTTTCAACAATCTGATCGTCTTCTCACTTTTCTCGGCTGCTTGGTACTTCGTGTCGTTCGTGGT
TGACAAAACCAAAAACCACGAAGACGCTTGGCAAGCCATCTTGGAAAGCCGGATGTATGCCAAATTGGTAAGCGC
TCTCTGCACCGTGTCACCGTTCTGGGTGACGTATCTTTTGCAGCGTAATCTCGGCGCTGCTATTGATCTGGTGCA
GTTCGTTACCATGGCTTGGGTCTGGTTCGCCAAGACGTTCCTCTCACCCACACCCCGACAGGCAATTGAGTGGAC
CGCACCGCCATCATTCGACTACGCCAGTTACTACAACTACTTCCTCTTCTATGCCACCGTGGCTTTCTGTTTCGC
TACCTTGCAACCCATCGTACTGCCGGTGACAGCATTGTATTTTGGTGTGGATGCCATGTTGAAGAAGTATCTATT
GATGTACGTGTTCGTGACTAAGAATGAGTCTGGTGGTGCGTTTTGGCGTGTGTTATTCAATCGCATGATCTTCGC
TACTATTCTTGCGAACGTGATCATCGCTCTCGTGGCCAAATCGAGCGGCACGTGGAACATGGTGTTCTGCGTGAT
TCCCCTGCCTTTCTTGATGATTGGATTCAAGATCTATTGCATGAAGACGTTTGACTCCGATTGCGAGTTTGTAAA
CCGTGCAAATCTAAGCGATGCCGAGGCCTTAGGTGTGAACACCTCAGACAAGAAAGCGTCAGACCGTCTGAATAC
CAAGTTCGGACACCCTGCCCTGTACAAACCACTTTTGACACCCATGGTGCACGCCAAGGCAGCCGCAGCACTAAA
AGAAATCTACCAAGGTCGTCTGGACCAGGGTGACATGGGCGGCGAGTACTCAGACATTGCAATGAACCCGATGCT
GGCCTCCCAGCCCGGCAAGTCTGCCGAACCCGCGCCCTTCGAGGTCGTCCCGGAGAACCATCTAGACTTCTCCTA
CTACAAGGATCGAGCAGACTTCCGAGACGAGTTCGGAGGCGGCATCTACGGCCGGCCTGATGACCTGATGACAGA
GCGGTCACATACACCCCGCAGTACTTTGCGAGGCGAGTGGTCTCCCGGCTCATCTCGTGCCTCATCACCCGCACC
CTCTCTGCCATCAATGCCGCTGAACATGCACAAGGGTTACGAACACGAACACTCCGACCCGACCGGGCTTATCCA
CCCGGCCTTCCGTGTGCCGCTATCGCGGGGCAACAGTGGCAGGTCGGCTGCAAACGCAGACGAGTCGGAGTCCGG
ACTCCTCAGCAATGCACAGGCTCCTGGGCAGACGGATATCACGAATCCGCTCGGTCGCTGGAGGACCGGTGGTTA
TGGACCAGTCGACCAGGAAGACGAGCCCTCGTATACTTCTTACGACGCTTACCGTTCACATGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail