Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g779.t1
Gene name
Locationscaffold_01:2083415..2085228
Strand+
Gene length (bp)1813
Transcript length (bp)1572
Coding sequence length (bp)1572
Protein length (aa) 524

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 3.6E-129 42 517

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22
2 142 161 19
3 174 196 22
4 227 249 22
5 262 284 22
6 358 380 22
7 393 415 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g779.t1
MADVRDSVEGNVSGDEEDVDKQGLRATEHDLEQANSKAVFNSKKALWGFLVLCYSTGPTSSMVSNYVTAAILSAA
NLLGHQAGSNKPCSRRGTNISCLVEFGGGEIDYNSYTLYLRAISRAMEGIVSILTAGLADYANYRKTMMMTSIFL
FGALALPFAGLTGQSYSHLTALSVLYCFLTTVGGVYTVIEGSYIPIFMRSTGWFRDSLVAASQDERATWNKGVSI
SVLALVSGNVGGLTALIIGVILVYGRGSYVQVGYFNYVLAITIAGCITILFAFLGQYLLPSVPGKKLDRTKNKFP
LLIAFKNWLKLLKSVTHYSEAFKFCIGWVLWNTGYSNHLQLIGALFLQVTGFSRSSGVYSVWSFTSVIFACTGSL
SFMYLHRRLRLPVKSYAYAFLVVNILCVLWGCIGISNHVTIGYKHQVEFWVEQVLFMSTSSALRAYNRAIYSSMI
PENSEAQFFGLEITLDLATGWVNPLVMGIIQDRTHNLRFPMIPNLFLMLVGLGLYSQVDIGKGIQQAKVPLVQ*
Coding >Pro_DTO377G3_2|g779.t1
ATGGCCGACGTGAGGGATTCTGTTGAAGGAAACGTCTCTGGAGACGAGGAAGACGTGGACAAGCAAGGACTTCGG
GCCACAGAACACGATCTGGAGCAAGCCAATTCCAAGGCTGTCTTTAACTCGAAGAAAGCACTGTGGGGATTCTTG
GTGCTATGCTATTCGACTGGCCCAACATCTTCCATGGTTTCGAATTATGTGACTGCGGCCATCCTCTCGGCAGCC
AATCTCCTGGGCCACCAGGCCGGATCTAACAAGCCATGCTCACGCCGTGGAACAAACATCAGTTGTCTAGTGGAA
TTCGGTGGAGGGGAGATCGACTATAACAGCTATACATTGTACCTTCGAGCAATCAGTCGCGCCATGGAAGGCATA
GTATCGATTCTCACGGCCGGCTTAGCAGACTATGCCAACTACCGCAAGACGATGATGATGACCTCGATATTTCTG
TTCGGGGCATTAGCCTTGCCTTTTGCAGGACTCACGGGTCAGAGTTATAGCCATCTGACCGCCTTGTCTGTGCTA
TATTGCTTCTTAACGACGGTCGGAGGTGTCTATACTGTGATCGAGGGGTCATACATTCCGATCTTTATGAGATCG
ACGGGCTGGTTCCGTGACTCCCTTGTAGCGGCAAGCCAGGACGAGAGAGCGACGTGGAACAAAGGAGTCTCTATT
AGTGTTCTGGCTTTGGTTTCGGGCAATGTCGGTGGCTTGACTGCCCTGATCATCGGTGTCATTCTTGTGTATGGG
CGGGGGTCTTATGTGCAGGTTGGGTACTTCAACTACGTTCTAGCCATCACAATTGCGGGCTGCATCACAATCCTG
TTTGCATTCCTTGGCCAGTACCTTCTCCCATCAGTGCCCGGCAAAAAGCTCGACCGCACGAAAAACAAATTCCCT
CTGCTGATCGCCTTCAAAAACTGGCTGAAACTGCTGAAAAGCGTAACGCACTATTCGGAAGCATTCAAATTCTGC
ATCGGTTGGGTTCTATGGAACACCGGCTATTCCAACCACCTGCAGCTCATCGGCGCGCTCTTCCTCCAGGTCACT
GGATTTTCCCGCAGTTCCGGGGTATACTCGGTCTGGTCCTTTACCAGCGTGATCTTTGCCTGCACAGGCAGCTTG
AGCTTCATGTATCTCCACCGGCGACTTCGGCTCCCCGTGAAATCATACGCATATGCCTTCCTCGTGGTGAATATC
CTATGTGTGCTGTGGGGCTGCATCGGAATCAGCAACCATGTTACAATTGGTTATAAGCACCAGGTCGAGTTCTGG
GTTGAGCAGGTCCTGTTCATGTCGACTAGTAGTGCGCTTCGGGCGTATAACCGTGCAATCTACTCTTCCATGATT
CCGGAGAACTCGGAAGCGCAGTTTTTCGGTCTGGAGATCACTTTGGATCTCGCGACTGGGTGGGTCAATCCTCTG
GTAATGGGTATTATCCAGGATCGGACGCATAATTTGCGCTTTCCGATGATTCCGAACTTGTTTCTGATGCTTGTT
GGACTTGGTCTTTACTCGCAGGTGGATATTGGCAAGGGGATCCAGCAGGCAAAGGTACCGTTGGTACAGTAG
Transcript >Pro_DTO377G3_2|g779.t1
ATGGCCGACGTGAGGGATTCTGTTGAAGGAAACGTCTCTGGAGACGAGGAAGACGTGGACAAGCAAGGACTTCGG
GCCACAGAACACGATCTGGAGCAAGCCAATTCCAAGGCTGTCTTTAACTCGAAGAAAGCACTGTGGGGATTCTTG
GTGCTATGCTATTCGACTGGCCCAACATCTTCCATGGTTTCGAATTATGTGACTGCGGCCATCCTCTCGGCAGCC
AATCTCCTGGGCCACCAGGCCGGATCTAACAAGCCATGCTCACGCCGTGGAACAAACATCAGTTGTCTAGTGGAA
TTCGGTGGAGGGGAGATCGACTATAACAGCTATACATTGTACCTTCGAGCAATCAGTCGCGCCATGGAAGGCATA
GTATCGATTCTCACGGCCGGCTTAGCAGACTATGCCAACTACCGCAAGACGATGATGATGACCTCGATATTTCTG
TTCGGGGCATTAGCCTTGCCTTTTGCAGGACTCACGGGTCAGAGTTATAGCCATCTGACCGCCTTGTCTGTGCTA
TATTGCTTCTTAACGACGGTCGGAGGTGTCTATACTGTGATCGAGGGGTCATACATTCCGATCTTTATGAGATCG
ACGGGCTGGTTCCGTGACTCCCTTGTAGCGGCAAGCCAGGACGAGAGAGCGACGTGGAACAAAGGAGTCTCTATT
AGTGTTCTGGCTTTGGTTTCGGGCAATGTCGGTGGCTTGACTGCCCTGATCATCGGTGTCATTCTTGTGTATGGG
CGGGGGTCTTATGTGCAGGTTGGGTACTTCAACTACGTTCTAGCCATCACAATTGCGGGCTGCATCACAATCCTG
TTTGCATTCCTTGGCCAGTACCTTCTCCCATCAGTGCCCGGCAAAAAGCTCGACCGCACGAAAAACAAATTCCCT
CTGCTGATCGCCTTCAAAAACTGGCTGAAACTGCTGAAAAGCGTAACGCACTATTCGGAAGCATTCAAATTCTGC
ATCGGTTGGGTTCTATGGAACACCGGCTATTCCAACCACCTGCAGCTCATCGGCGCGCTCTTCCTCCAGGTCACT
GGATTTTCCCGCAGTTCCGGGGTATACTCGGTCTGGTCCTTTACCAGCGTGATCTTTGCCTGCACAGGCAGCTTG
AGCTTCATGTATCTCCACCGGCGACTTCGGCTCCCCGTGAAATCATACGCATATGCCTTCCTCGTGGTGAATATC
CTATGTGTGCTGTGGGGCTGCATCGGAATCAGCAACCATGTTACAATTGGTTATAAGCACCAGGTCGAGTTCTGG
GTTGAGCAGGTCCTGTTCATGTCGACTAGTAGTGCGCTTCGGGCGTATAACCGTGCAATCTACTCTTCCATGATT
CCGGAGAACTCGGAAGCGCAGTTTTTCGGTCTGGAGATCACTTTGGATCTCGCGACTGGGTGGGTCAATCCTCTG
GTAATGGGTATTATCCAGGATCGGACGCATAATTTGCGCTTTCCGATGATTCCGAACTTGTTTCTGATGCTTGTT
GGACTTGGTCTTTACTCGCAGGTGGATATTGGCAAGGGGATCCAGCAGGCAAAGGTACCGTTGGTACAGTAG
Gene >Pro_DTO377G3_2|g779.t1
ATGGCCGACGTGAGGGATTCTGTTGAAGGAAACGTCTCTGGAGACGAGGAAGACGTGGACAAGCAAGGACTTCGG
GCCACAGAACACGATCTGGAGCAAGCCAATTCCAAGGCTGTCTTTAACTCGAAGAAAGCACTGTGGGGATTCTTG
GTGCTATGCTATTCGGTACGCGGGGACTGATGCTTACTTTGGATTGACATCTGCTTGAGCGAGATGACATGCTGA
TAATGCATTCGCCCAATTCCAGACTGGCCCAACATCTTCCATGGTTTCGAATTATGTGACTGCGGCCATCCTCTC
GGCAGCCAATCTCCTGGGCCACCAGGCCGGATCTAACAAGCCATGCTCACGCCGTGGAACAAACATCAGTTGTCT
AGTGGAATTCGGTGGAGGGGAGATCGACTATAACAGCTATACGTGCGTATCGTGGCATTGAGGTGCGGGGTGACT
TTGCTGACGAGAAGAAAGATTGTACCTTCGAGCAATCAGTCGCGCCATGGAAGGCATAGTATCGATTCTCACGGC
CGGCTTAGCAGACTATGCCAGTGAGTAGAACGAATTGACACCTTTGGATTTTTAGCGCTGATCCAGATACCTCCA
GACTACCGCAAGACGATGATGATGACCTCGATATTTCTGTTCGGGGCATTAGCCTTGCCTTTTGCAGGACTCACG
GGTCAGAGTTATAGCCATCTGACCGCCTTGTCTGTGCTATATTGCTTCTTAACGACGGTCGGAGGTGTCTATACT
GTGATCGAGGGGTCATACATTCCGATCTTTATGAGATCGACGGGCTGGTTCCGTGACTCCCTTGTAGCGGCAAGC
CAGGACGAGAGAGCGACGTGGAACAAAGGAGTCTCTATTAGTGTTCTGGCTTTGGTTTCGGGCAATGTCGGTGGC
TTGACTGCCCTGATCATCGGTGTCATTCTTGTGTATGGGCGGGGGTCTTATGTGCAGGTTGGGTACTTCAACTAC
GTTCTAGCCATCACAATTGCGGGCTGCATCACAAGTAGGTTGTACTTAGTTCTAGATCATGAATCCCCGATAGCT
GACTTTCCCAGTCCTGTTTGCATTCCTTGGCCAGTACCTTCTCCCATCAGTGCCCGGCAAAAAGCTCGACCGCAC
GAAAAACAAATTCCCTCTGCTGATCGCCTTCAAAAACTGGCTGAAACTGCTGAAAAGCGTAACGCACTATTCGGA
AGCATTCAAATTCTGCATCGGTTGGGTTCTATGGAACACCGGCTATTCCAACCACCTGCAGCTCATCGGCGCGCT
CTTCCTCCAGGTCACTGGATTTTCCCGCAGTTCCGGGGTATACTCGGTCTGGTCCTTTACCAGCGTGATCTTTGC
CTGCACAGGCAGCTTGAGCTTCATGTATCTCCACCGGCGACTTCGGCTCCCCGTGAAATCATACGCATATGCCTT
CCTCGTGGTGAATATCCTATGTGTGCTGTGGGGCTGCATCGGAATCAGCAACCATGTTACAATTGGTTATAAGCA
CCAGGTCGAGTTCTGGGTTGAGCAGGTCCTGTTCATGTCGACTAGTAGTGCGCTTCGGGCGTATAACCGTGCAAT
CTACTCTTCCATGATTCCGGAGAACTCGGAAGCGCAGTTTTTCGGTCTGGAGATCACTTTGGATCTCGCGACTGG
GTGGGTCAATCCTCTGGTAATGGGTATTATCCAGGATCGGACGCATAATTTGCGCTTTCCGATGATTCCGAACTT
GTTTCTGATGCTTGTTGGACTTGGTCTTTACTCGCAGGTGGATATTGGCAAGGGGATCCAGCAGGCAAAGGTACC
GTTGGTACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail