Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7777.t1
Gene name
Locationscaffold_26:64681..68212
Strand+
Gene length (bp)3531
Transcript length (bp)3252
Coding sequence length (bp)3252
Protein length (aa) 1084

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02171 Piwi Piwi domain 6.3E-60 731 1035
PF16486 ArgoN N-terminal domain of argonaute 4.9E-13 214 354
PF08699 ArgoL1 Argonaute linker 1 domain 2.8E-12 364 422
PF02170 PAZ PAZ domain 1.1E-09 455 574
PF16487 ArgoMid Mid domain of argonaute 9.3E-08 640 702
PF16488 ArgoL2 Argonaute linker 2 domain 4.2E-07 592 629

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7777.t1
MAPKKAMKPPSKEGKEEERSLSGHRPPPTAAMNTSSKPPPSSSSSRQTRGLPLRLSTPAAKPLDPRQIQELRDHK
AKLEDDARRKKEEESTAWMRRTNYDPDAGEYKRPKSTGSSSSDSPIRRVQTPPEFPENWTAEERANYVRLAREGV
KVAVFEQHRLDLEKVEHHEDYMTVVWDGCKNIDIPWHRFKIMPASSAPEETQIQRRIGYNTSGKEIEVMMNAYPI
TSFPDKAVYQYEINVLHGDQNETDRRILRKCWNSETRKAHIPDGIWDGGRICWSLRNFDDWNEIIDFRSEFTRDV
KTLTKNQYKTSPTFRMSVMQKRKINLSVINSWLQNRHDLDQLVIESLSFLDHLLREWPTKQFAAIKRAFFFDKLG
DDEELKQEFYQPLANMGASVYRGIYQAIKPTPQGLILNVDVAHCVFFSRISLMGYMMNVNGWNDKSTLVRNLQST
RDEFGGTKESRYFAQVNKRIQGLRVAPNYEGCPFKMKSFIVKGLIHAKPNEFYISYHDKATGTSTRMHLQDYFMK
RYNIRLEYPNMLLVEMVKEDVHYPAEFLVIKGLQRYRYKLTDMQAAQMIQWCATRPPKRLANARQSKELLQHKED
PILKLYGMKISDHMIKTKARLLPSPEIQFGGNRKHNPQHAGSWDLRGKKFYKPNEKALQAWGVGFFSGHRKSISH
DQTLNWVDQFVKMYKSMGGDVTGRPVVKGLSEDVGMSVKKLYDAIAAQNKSEPQLMVFIVPDKDSWVYLRLKKSS
DCRYGTPSQVLQSAHCISNRPQYHANVLMKVNAKLGGVTARAVPKSKSQGLRPGSMIIGADVTHPMMGVWTPSLA
AMSVSANSTATRYMGGCETNGDRVEVIRDKVIEYILHPMVAEWKATVGGGKAPEYVYYFRDGVSASEYRRILSEE
VPAIRFAIAHACGQPVWAGKMCVVVANKRHHLRAFPDPKNRAAADSHGAPLPGTLIDRDVTSPHDWDFLLYTHIA
LQGTPRPVHYHVLLDEMGLKPNDLEGMINDHCYQYIRSTTSVSVHPAIYYAHLISVRARHHEDVPITSGPQSGPE
VKMTNPKPKEPRAKRLLPIEGTLNRLALGMWYI*
Coding >Pro_DTO377G3_2|g7777.t1
ATGGCTCCGAAAAAGGCCATGAAGCCACCCTCGAAAGAGGGCAAAGAGGAGGAGAGGTCTCTTTCCGGGCACCGC
CCTCCTCCTACTGCTGCTATGAATACGTCTTCAAAGCCTCCTCCCTCCTCTTCATCCTCCCGTCAAACTAGGGGT
CTTCCTCTGCGCCTTTCTACCCCTGCGGCAAAGCCTCTGGATCCGCGCCAGATCCAAGAGCTGCGTGACCACAAG
GCCAAATTGGAAGATGACGCACGGCGCAAGAAAGAAGAAGAAAGTACTGCTTGGATGCGTCGAACCAACTATGAC
CCTGATGCGGGCGAGTACAAACGGCCCAAGAGCACTGGTTCTAGTAGCAGTGACTCTCCCATCCGTCGAGTCCAG
ACCCCTCCAGAATTTCCGGAAAACTGGACCGCGGAAGAAAGGGCAAACTACGTCCGCCTTGCAAGAGAAGGCGTG
AAAGTGGCTGTTTTTGAACAACACAGACTGGACCTTGAGAAGGTTGAGCACCATGAAGATTACATGACGGTTGTA
TGGGATGGCTGCAAGAACATTGACATTCCTTGGCATCGATTCAAAATCATGCCTGCTTCTTCTGCACCGGAGGAG
ACTCAAATCCAGCGTCGGATTGGTTACAACACTTCCGGCAAAGAGATTGAGGTTATGATGAACGCGTACCCGATC
ACTTCTTTCCCGGACAAGGCCGTCTACCAGTACGAGATCAATGTTCTCCACGGAGACCAGAACGAGACCGACAGA
CGGATCCTGAGAAAGTGCTGGAACAGTGAGACTCGAAAGGCACACATCCCTGATGGTATCTGGGATGGTGGAAGA
ATCTGCTGGTCGCTACGCAACTTCGATGACTGGAATGAGATTATTGACTTCAGGAGTGAATTTACCCGGGATGTC
AAGACTCTTACTAAGAATCAGTACAAGACGAGTCCTACTTTCAGAATGTCCGTCATGCAAAAGAGGAAGATCAAT
CTGTCAGTGATCAACTCCTGGTTGCAGAATCGCCATGATCTGGATCAACTCGTGATTGAATCTCTGAGCTTCCTT
GATCATTTGCTCCGTGAATGGCCCACCAAACAGTTCGCCGCAATCAAGCGGGCCTTCTTCTTCGACAAGCTTGGA
GACGACGAGGAGCTGAAGCAGGAGTTTTACCAGCCGCTCGCCAACATGGGTGCTTCCGTTTACCGAGGAATCTAC
CAGGCAATTAAGCCAACTCCACAAGGTCTGATCCTCAATGTTGATGTCGCTCATTGCGTCTTCTTTTCTCGTATT
AGTCTTATGGGGTACATGATGAATGTGAACGGGTGGAACGATAAGTCGACCCTGGTCAGGAACCTACAGTCAACC
CGCGACGAATTTGGCGGTACGAAGGAATCGAGGTACTTCGCACAGGTGAACAAGAGAATTCAAGGTCTTCGAGTG
GCACCCAACTACGAGGGTTGTCCTTTCAAGATGAAAAGCTTCATTGTCAAGGGCCTGATTCACGCAAAGCCCAAT
GAGTTTTACATTAGCTATCACGACAAGGCTACTGGGACGTCTACTCGGATGCATCTTCAAGATTACTTCATGAAA
CGGTACAACATCCGCCTCGAATATCCCAATATGCTCTTGGTCGAGATGGTGAAGGAAGACGTTCATTACCCAGCC
GAATTCCTAGTCATCAAAGGCCTTCAGAGATACCGCTACAAACTTACCGATATGCAGGCGGCGCAGATGATCCAA
TGGTGTGCAACCAGGCCTCCGAAGCGTTTGGCCAATGCTCGCCAGTCCAAGGAACTTCTCCAGCACAAGGAGGAC
CCGATCCTGAAGCTTTACGGTATGAAGATCAGTGACCACATGATCAAAACAAAGGCTCGCCTGCTTCCGAGTCCT
GAGATTCAGTTCGGGGGCAACCGCAAGCACAACCCGCAGCATGCGGGAAGTTGGGATCTCCGCGGTAAGAAGTTT
TACAAACCCAATGAAAAGGCCCTCCAGGCTTGGGGTGTTGGCTTCTTTTCCGGACATCGAAAGTCAATCAGCCAT
GACCAAACCCTCAACTGGGTCGACCAGTTTGTCAAGATGTACAAGAGCATGGGTGGTGATGTGACTGGCCGACCG
GTTGTCAAAGGATTGAGCGAAGACGTTGGCATGAGTGTCAAAAAGCTGTACGATGCGATCGCAGCGCAGAACAAG
AGTGAGCCACAGCTCATGGTCTTCATCGTTCCCGACAAGGACTCCTGGGTCTATCTTCGTCTCAAGAAGTCTTCC
GACTGCCGGTACGGCACCCCCTCTCAAGTGCTCCAATCTGCACACTGCATCAGCAATAGACCTCAATACCACGCA
AATGTTCTCATGAAGGTGAATGCAAAGCTTGGTGGAGTCACTGCTCGGGCTGTCCCCAAGTCAAAGAGTCAAGGT
CTACGCCCAGGCTCCATGATCATTGGTGCAGACGTCACTCATCCAATGATGGGTGTGTGGACCCCGTCGTTGGCA
GCCATGTCGGTTTCGGCAAACTCCACTGCAACTCGCTACATGGGTGGATGCGAGACTAATGGAGATCGAGTTGAG
GTTATCCGGGATAAAGTGATCGAGTACATCCTGCACCCCATGGTTGCTGAGTGGAAAGCGACTGTTGGGGGCGGC
AAGGCTCCTGAGTATGTCTACTATTTCCGTGACGGTGTTTCTGCGTCCGAATACCGGAGAATTCTTTCAGAGGAG
GTCCCTGCAATCCGCTTTGCAATTGCACATGCATGTGGTCAGCCAGTCTGGGCAGGCAAGATGTGTGTTGTGGTT
GCCAACAAGCGCCACCATCTTCGAGCGTTCCCTGACCCCAAGAATCGCGCAGCCGCAGACTCCCACGGAGCTCCT
TTGCCGGGCACTCTTATTGATCGGGATGTTACTAGCCCACATGACTGGGACTTCCTGCTCTACACACACATTGCT
CTGCAAGGAACTCCCCGCCCAGTCCATTACCATGTCCTGTTGGATGAGATGGGTCTCAAGCCCAATGACCTTGAG
GGTATGATCAATGACCATTGCTACCAGTACATCCGCTCGACAACCTCTGTGTCTGTACACCCAGCAATCTACTAT
GCCCACTTGATTTCGGTTCGTGCTCGCCACCACGAGGATGTTCCTATTACCTCTGGCCCCCAGAGTGGCCCGGAG
GTGAAAATGACAAACCCGAAGCCCAAGGAACCCCGAGCCAAGAGATTGCTTCCCATTGAAGGCACCTTAAACAGG
CTGGCCCTGGGTATGTGGTACATCTAA
Transcript >Pro_DTO377G3_2|g7777.t1
ATGGCTCCGAAAAAGGCCATGAAGCCACCCTCGAAAGAGGGCAAAGAGGAGGAGAGGTCTCTTTCCGGGCACCGC
CCTCCTCCTACTGCTGCTATGAATACGTCTTCAAAGCCTCCTCCCTCCTCTTCATCCTCCCGTCAAACTAGGGGT
CTTCCTCTGCGCCTTTCTACCCCTGCGGCAAAGCCTCTGGATCCGCGCCAGATCCAAGAGCTGCGTGACCACAAG
GCCAAATTGGAAGATGACGCACGGCGCAAGAAAGAAGAAGAAAGTACTGCTTGGATGCGTCGAACCAACTATGAC
CCTGATGCGGGCGAGTACAAACGGCCCAAGAGCACTGGTTCTAGTAGCAGTGACTCTCCCATCCGTCGAGTCCAG
ACCCCTCCAGAATTTCCGGAAAACTGGACCGCGGAAGAAAGGGCAAACTACGTCCGCCTTGCAAGAGAAGGCGTG
AAAGTGGCTGTTTTTGAACAACACAGACTGGACCTTGAGAAGGTTGAGCACCATGAAGATTACATGACGGTTGTA
TGGGATGGCTGCAAGAACATTGACATTCCTTGGCATCGATTCAAAATCATGCCTGCTTCTTCTGCACCGGAGGAG
ACTCAAATCCAGCGTCGGATTGGTTACAACACTTCCGGCAAAGAGATTGAGGTTATGATGAACGCGTACCCGATC
ACTTCTTTCCCGGACAAGGCCGTCTACCAGTACGAGATCAATGTTCTCCACGGAGACCAGAACGAGACCGACAGA
CGGATCCTGAGAAAGTGCTGGAACAGTGAGACTCGAAAGGCACACATCCCTGATGGTATCTGGGATGGTGGAAGA
ATCTGCTGGTCGCTACGCAACTTCGATGACTGGAATGAGATTATTGACTTCAGGAGTGAATTTACCCGGGATGTC
AAGACTCTTACTAAGAATCAGTACAAGACGAGTCCTACTTTCAGAATGTCCGTCATGCAAAAGAGGAAGATCAAT
CTGTCAGTGATCAACTCCTGGTTGCAGAATCGCCATGATCTGGATCAACTCGTGATTGAATCTCTGAGCTTCCTT
GATCATTTGCTCCGTGAATGGCCCACCAAACAGTTCGCCGCAATCAAGCGGGCCTTCTTCTTCGACAAGCTTGGA
GACGACGAGGAGCTGAAGCAGGAGTTTTACCAGCCGCTCGCCAACATGGGTGCTTCCGTTTACCGAGGAATCTAC
CAGGCAATTAAGCCAACTCCACAAGGTCTGATCCTCAATGTTGATGTCGCTCATTGCGTCTTCTTTTCTCGTATT
AGTCTTATGGGGTACATGATGAATGTGAACGGGTGGAACGATAAGTCGACCCTGGTCAGGAACCTACAGTCAACC
CGCGACGAATTTGGCGGTACGAAGGAATCGAGGTACTTCGCACAGGTGAACAAGAGAATTCAAGGTCTTCGAGTG
GCACCCAACTACGAGGGTTGTCCTTTCAAGATGAAAAGCTTCATTGTCAAGGGCCTGATTCACGCAAAGCCCAAT
GAGTTTTACATTAGCTATCACGACAAGGCTACTGGGACGTCTACTCGGATGCATCTTCAAGATTACTTCATGAAA
CGGTACAACATCCGCCTCGAATATCCCAATATGCTCTTGGTCGAGATGGTGAAGGAAGACGTTCATTACCCAGCC
GAATTCCTAGTCATCAAAGGCCTTCAGAGATACCGCTACAAACTTACCGATATGCAGGCGGCGCAGATGATCCAA
TGGTGTGCAACCAGGCCTCCGAAGCGTTTGGCCAATGCTCGCCAGTCCAAGGAACTTCTCCAGCACAAGGAGGAC
CCGATCCTGAAGCTTTACGGTATGAAGATCAGTGACCACATGATCAAAACAAAGGCTCGCCTGCTTCCGAGTCCT
GAGATTCAGTTCGGGGGCAACCGCAAGCACAACCCGCAGCATGCGGGAAGTTGGGATCTCCGCGGTAAGAAGTTT
TACAAACCCAATGAAAAGGCCCTCCAGGCTTGGGGTGTTGGCTTCTTTTCCGGACATCGAAAGTCAATCAGCCAT
GACCAAACCCTCAACTGGGTCGACCAGTTTGTCAAGATGTACAAGAGCATGGGTGGTGATGTGACTGGCCGACCG
GTTGTCAAAGGATTGAGCGAAGACGTTGGCATGAGTGTCAAAAAGCTGTACGATGCGATCGCAGCGCAGAACAAG
AGTGAGCCACAGCTCATGGTCTTCATCGTTCCCGACAAGGACTCCTGGGTCTATCTTCGTCTCAAGAAGTCTTCC
GACTGCCGGTACGGCACCCCCTCTCAAGTGCTCCAATCTGCACACTGCATCAGCAATAGACCTCAATACCACGCA
AATGTTCTCATGAAGGTGAATGCAAAGCTTGGTGGAGTCACTGCTCGGGCTGTCCCCAAGTCAAAGAGTCAAGGT
CTACGCCCAGGCTCCATGATCATTGGTGCAGACGTCACTCATCCAATGATGGGTGTGTGGACCCCGTCGTTGGCA
GCCATGTCGGTTTCGGCAAACTCCACTGCAACTCGCTACATGGGTGGATGCGAGACTAATGGAGATCGAGTTGAG
GTTATCCGGGATAAAGTGATCGAGTACATCCTGCACCCCATGGTTGCTGAGTGGAAAGCGACTGTTGGGGGCGGC
AAGGCTCCTGAGTATGTCTACTATTTCCGTGACGGTGTTTCTGCGTCCGAATACCGGAGAATTCTTTCAGAGGAG
GTCCCTGCAATCCGCTTTGCAATTGCACATGCATGTGGTCAGCCAGTCTGGGCAGGCAAGATGTGTGTTGTGGTT
GCCAACAAGCGCCACCATCTTCGAGCGTTCCCTGACCCCAAGAATCGCGCAGCCGCAGACTCCCACGGAGCTCCT
TTGCCGGGCACTCTTATTGATCGGGATGTTACTAGCCCACATGACTGGGACTTCCTGCTCTACACACACATTGCT
CTGCAAGGAACTCCCCGCCCAGTCCATTACCATGTCCTGTTGGATGAGATGGGTCTCAAGCCCAATGACCTTGAG
GGTATGATCAATGACCATTGCTACCAGTACATCCGCTCGACAACCTCTGTGTCTGTACACCCAGCAATCTACTAT
GCCCACTTGATTTCGGTTCGTGCTCGCCACCACGAGGATGTTCCTATTACCTCTGGCCCCCAGAGTGGCCCGGAG
GTGAAAATGACAAACCCGAAGCCCAAGGAACCCCGAGCCAAGAGATTGCTTCCCATTGAAGGCACCTTAAACAGG
CTGGCCCTGGGTATGTGGTACATCTAA
Gene >Pro_DTO377G3_2|g7777.t1
ATGGCTCCGAAAAAGGCCATGAAGCCACCCTCGAAAGAGGGCAAAGAGGAGGAGAGGTCTCTTTCCGGGCACCGC
CCTCCTCCTACTGCTGCTATGAATACGTCTTCAAAGCCTCCTCCCTCCTCTTCATCCTCCCGTCAAACTAGGGGT
CTTCCTCTGCGCCTTTCTACCCCTGCGGCAAAGCCTCTGGATCCGCGCCAGATCCAAGAGCTGCGTGACCACAAG
GCCAAATTGGAAGATGACGCACGGCGCAAGAAAGAAGAAGAAAGTACTGCTTGGATGCGTCGAACCAACTATGAC
CCTGATGCGGGCGAGTACAAACGGCCCAAGAGCACTGGTTCTAGTAGCAGTGACTCTCCCATCCGTCGAGTCCAG
ACCCCTCCAGAATTTCCGGAAAACTGGACCGCGGAAGAAAGGGCAAACTACGTCCGCCTTGCAAGAGAAGGCGTG
AAAGTGGCTGTTTTTGAACAACACAGACTGGACCTTGAGAAGGTTGAGCACCATGAAGATTACATGACGGTTGTA
TGGGATGGCTGCAAGAACATTGACATTCCTTGGCATCGATTCAAAATCATGCCTGCTTCTGTAAGTCATTCCCAA
TAGCTCTGTGGTTGATGGATTTTACTAACCTTTTTGTCTAGTCTGCACCGGAGGAGACTCAAATCCAGCGTCGGA
TTGGTTACAACACTTCCGGCAAAGAGATTGAGGTTATGATGAACGCGTACCCGATCACTTCTTTCCCGGACAAGG
CCGTCTACCAGTACGAGGTGAGTGTTTTTCCCCCTCCATCTAATGCCATTCTTCGCTCATCAATTTTTAGATCAA
TGTTCTCCACGGAGACCAGAACGAGACCGACAGACGGATCCTGAGAAAGTGCTGGAACAGTGAGACTCGAAAGGC
ACACATCCCTGATGGTATCTGGGATGGTGGAAGAATCTGCTGGTAAGTGCAATGTATCGAATTGCTGTTATATAT
TTTCTAACCTGTGTTGCAGGTCGCTACGCAACTTCGATGACTGGAATGAGATTATTGACTTCAGGAGTGAATTTA
CCCGGGATGTCAAGACTCTTACTAAGAATCAGTACAAGACGAGTCCTACTTTCAGAATGTCCGTCATGCAAAAGA
GGAAGATCAATCTGTCAGTGATCAACTCCTGGTTGCAGAATCGCCATGATCTGGATCAACTCGTGATTGAATCTC
TGAGTAAGTGCTCCCTTATTCCGCATCTTCCTCTGTTTATGATTCATCAGGCTGATAATGATAGGCTTCCTTGAT
CATTTGCTCCGTGAATGGCCCACCAAACAGTTCGCCGCAATCAAGCGGGCCTTCTTCTTCGACAAGCTTGGAGAC
GACGAGGAGCTGAAGCAGGAGTTTTACCAGCCGCTCGCCAACATGGGTGCTTCCGTTTACCGAGGAATCTACCAG
GCAATTAAGCCAACTCCAGTAAGGCTCAATCCATTGATTCGAACCCAAGATTGGTATACTGACATTTACTTATAG
CAAGGTCTGATCCTCAATGTTGATGTCGCTCATTGCGTCTTCTTTTCTCGTATTAGTCTTATGGGGTACATGATG
AATGTGAACGGGTGGAACGATAAGTCGACCCTGGTCAGGAACCTACAGTCAACCCGCGACGAATTTGGCGGTACG
AAGGAATCGAGGTACTTCGCACAGGTGAACAAGAGAATTCAAGGTCTTCGAGTGGCACCCAACTACGAGGGTTGT
CCTTTCAAGATGAAAAGCTTCATTGTCAAGGGCCTGATTCACGCAAAGCCCAATGAGTTTTACATTAGCTATCAC
GACAAGGCTACTGGGACGTCTACTCGGATGCATCTTCAAGATTACTTCATGAAACGGTACAACATCCGCCTCGAA
TATCCCAATATGCTCTTGGTCGAGATGGTGAAGGAAGACGTTCATTACCCAGCCGAATTCCTAGTCATCAAAGGC
CTTCAGAGATACCGCTACAAACTTACCGATATGCAGGCGGCGCAGATGATCCAATGGTGTGCAACCAGGCCTCCG
AAGCGTTTGGCCAATGCTCGCCAGTCCAAGGAACTTCTCCAGCACAAGGAGGACCCGATCCTGAAGCTTTACGGT
ATGAAGATCAGTGACCACATGATCAAAACAAAGGCTCGCCTGCTTCCGAGTCCTGAGATTCAGTTCGGGGGCAAC
CGCAAGCACAACCCGCAGCATGCGGGAAGTTGGGATCTCCGCGGTAAGAAGTTTTACAAACCCAATGAAAAGGCC
CTCCAGGCTTGGGGTGTTGGCTTCTTTTCCGGACATCGAAAGTCAATCAGCCATGACCAAACCCTCAACTGGGTC
GACCAGTTTGTCAAGATGTACAAGAGCATGGGTGGTGATGTGACTGGCCGACCGGTTGTCAAAGGATTGAGCGAA
GACGTTGGCATGAGTGTCAAAAAGCTGTACGATGCGATCGCAGCGCAGAACAAGAGTGAGCCACAGCTCATGGTC
TTCATCGTTCCCGACAAGGACTCCTGGGTCTATCTTCGTCTCAAGAAGTCTTCCGACTGCCGGTACGGCACCCCC
TCTCAAGTGCTCCAATCTGCACACTGCATCAGCAATAGACCTCAATACCACGCAAATGTTCTCATGAAGGTGAAT
GCAAAGCTTGGTGGAGTCACTGCTCGGGCTGTCCCCAAGTCAAAGAGTCAAGGTCTACGCCCAGGCTCCATGATC
ATTGGTGCAGACGTCACTCATCCAATGATGGGTGTGTGGACCCCGTCGTTGGCAGCCATGTCGGTTTCGGCAAAC
TCCACTGCAACTCGCTACATGGGTGGATGCGAGACTAATGGAGATCGAGTTGAGGTTATCCGGGATAAAGTGATC
GAGTACATCCTGCACCCCATGGTTGCTGAGTGGAAAGCGACTGTTGGGGGCGGCAAGGCTCCTGAGTATGTCTAC
TATTTCCGTGACGGTGTTTCTGCGTCCGAATACCGGAGAATTCTTTCAGAGGAGGTCCCTGCAATCCGCTTTGCA
ATTGCACATGCATGTGGTCAGCCAGTCTGGGCAGGCAAGATGTGTGTTGTGGTTGCCAACAAGCGCCACCATCTT
CGAGCGTTCCCTGACCCCAAGAATCGCGCAGCCGCAGACTCCCACGGAGCTCCTTTGCCGGGCACTCTTATTGAT
CGGGATGTTACTAGCCCACATGACTGGGACTTCCTGCTCTACACACACATTGCTCTGCAAGGAACTCCCCGCCCA
GTCCATTACCATGTCCTGTTGGATGAGATGGGTCTCAAGCCCAATGACCTTGAGGGTATGATCAATGACCATTGC
TACCAGTACATCCGCTCGACAACCTCTGTGTCTGTACACCCAGCAATCTACTATGCCCACTTGATTTCGGTTCGT
GCTCGCCACCACGAGGATGTTCCTATTACCTCTGGCCCCCAGAGTGGCCCGGAGGTGAAAATGACAAACCCGAAG
CCCAAGGAACCCCGAGCCAAGAGATTGCTTCCCATTGAAGGCACCTTAAACAGGCTGGCCCTGGGTATGTGGTAC
ATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail