Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7763.t1
Gene name
Locationscaffold_26:20497..22286
Strand-
Gene length (bp)1789
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain 1.4E-77 65 451
PF00266 Aminotran_5 Aminotransferase class-V 7.4E-05 201 292
PF01212 Beta_elim_lyase Beta-eliminating lyase 8.9E-05 200 291

GO

GO Term Description Terminal node
GO:0030170 pyridoxal phosphate binding Yes
GO:0016829 lyase activity Yes
GO:0019752 carboxylic acid metabolic process Yes
GO:0016831 carboxy-lyase activity Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0070279 vitamin B6 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0019842 vitamin binding No
GO:0003824 catalytic activity No
GO:0016830 carbon-carbon lyase activity No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7763.t1
MSGIAQPNRADEVQSLLKAVEDLLIPFIRSADEDPRGSLTQKNGTNGTNGHTGLVGTSLIDYKKPEELQDILQLE
IPEKGTKQEGLIEVLKKVLQYSVNTWHQGFLDKLYASTNAPGVAAELILATLNTNVHVYQVSPALTVIEKYTGQR
LANLFGLNGPQAGGISVQGGSASNTTSIVIARNNLYPSTKTDGNGGYKFVLFTSAHGHYSVEKAAQMLGFGSSAV
WPVPVDKVGRMIPAELEKLVQKAQSEGRTPFYVNATAGTTVLGSFDPFNEIAAICEKYNLWFHIDGSWGGSFVFS
QRQKHKLAGAEKANSIGINPHKMLGVPVTCSYLLASDIRQFHKANTLPAGYLFHSEEDEPATNGDANKESELEVD
SPEVWDLADLTLQCGRRADSLKLFLGWTYYGNEGYRQQIDSACDIAAHLANTIAQHPDFVLISENPPPCLQVCFY
YAPGKKFVYPRGIVSNETQRGKNNSKVTEQVTRAIVPKGFMVDFAPPSGEEDEDAAGNGKFFRCVVNVQTTKETV
DSLIRAIEEVGPGIIESLKASNPALPHKRPGERGHGPVVHRA*
Coding >Pro_DTO377G3_2|g7763.t1
ATGTCTGGCATTGCGCAGCCCAATCGCGCTGATGAAGTGCAAAGTCTTCTGAAAGCGGTGGAAGACCTTCTCATC
CCCTTTATCCGATCCGCAGACGAGGATCCCCGCGGGTCCTTGACACAGAAAAATGGCACCAACGGCACCAATGGA
CACACTGGACTCGTTGGAACCTCATTGATAGATTATAAGAAGCCTGAAGAGCTGCAGGATATCCTTCAGCTTGAG
ATCCCAGAGAAAGGCACCAAGCAGGAAGGTCTCATTGAAGTCTTGAAAAAGGTTCTGCAATACTCGGTCAACACC
TGGCACCAGGGATTTTTGGACAAGCTGTATGCGTCAACCAATGCGCCCGGCGTGGCAGCAGAGCTCATACTTGCT
ACCTTGAACACCAACGTACACGTCTACCAAGTGTCCCCTGCGCTGACGGTCATTGAGAAATATACCGGCCAGCGG
TTGGCGAACCTCTTCGGGCTGAACGGTCCACAGGCGGGAGGCATTTCCGTGCAGGGCGGATCCGCATCGAACACC
ACCTCCATTGTCATTGCGCGAAACAACCTATACCCCAGCACGAAGACAGACGGGAACGGCGGGTACAAGTTCGTG
CTCTTCACGAGCGCACACGGCCACTACAGCGTGGAAAAGGCAGCGCAGATGCTCGGGTTCGGCAGCAGTGCTGTC
TGGCCTGTTCCTGTTGACAAGGTCGGCCGCATGATCCCAGCCGAGCTTGAGAAACTGGTTCAGAAGGCGCAGAGC
GAAGGCCGGACGCCGTTCTATGTCAATGCCACCGCAGGCACAACCGTCCTAGGCTCTTTCGACCCCTTCAACGAA
ATCGCAGCCATTTGCGAAAAATACAACCTGTGGTTCCACATTGACGGATCCTGGGGTGGCTCGTTCGTTTTCTCC
CAGCGCCAGAAGCATAAGCTAGCTGGCGCAGAGAAAGCAAACAGCATCGGCATTAATCCGCACAAAATGCTTGGC
GTTCCGGTCACCTGCTCTTACCTGCTAGCCTCGGATATACGCCAGTTCCACAAGGCCAACACACTTCCCGCGGGG
TACCTATTCCACAGCGAAGAAGACGAGCCCGCTACCAACGGCGACGCAAACAAAGAATCCGAGTTGGAAGTCGAC
TCACCGGAAGTGTGGGATCTAGCAGACCTCACTCTCCAATGTGGTCGACGTGCGGATTCGTTGAAGCTGTTTTTG
GGTTGGACATACTATGGCAATGAGGGCTACCGACAGCAGATCGACTCGGCATGCGACATCGCTGCGCACTTGGCT
AATACCATCGCGCAACATCCTGATTTCGTTCTTATTAGCGAAAACCCTCCGCCCTGTCTGCAGGTGTGCTTTTAC
TACGCGCCAGGCAAGAAGTTCGTGTACCCGCGTGGCATCGTCTCGAATGAGACACAGCGCGGGAAGAATAACAGC
AAGGTCACTGAGCAGGTGACGCGTGCAATCGTGCCCAAGGGCTTCATGGTGGACTTTGCGCCTCCCAGTGGAGAG
GAGGACGAGGATGCAGCTGGGAATGGGAAGTTCTTCCGGTGCGTGGTGAATGTCCAGACGACGAAGGAGACCGTT
GATTCGCTTATCCGCGCCATCGAAGAGGTGGGTCCTGGTATTATTGAGTCTTTGAAGGCGAGCAACCCGGCGCTT
CCGCACAAGCGGCCTGGTGAGCGTGGACACGGACCTGTTGTCCATCGCGCTTGA
Transcript >Pro_DTO377G3_2|g7763.t1
ATGTCTGGCATTGCGCAGCCCAATCGCGCTGATGAAGTGCAAAGTCTTCTGAAAGCGGTGGAAGACCTTCTCATC
CCCTTTATCCGATCCGCAGACGAGGATCCCCGCGGGTCCTTGACACAGAAAAATGGCACCAACGGCACCAATGGA
CACACTGGACTCGTTGGAACCTCATTGATAGATTATAAGAAGCCTGAAGAGCTGCAGGATATCCTTCAGCTTGAG
ATCCCAGAGAAAGGCACCAAGCAGGAAGGTCTCATTGAAGTCTTGAAAAAGGTTCTGCAATACTCGGTCAACACC
TGGCACCAGGGATTTTTGGACAAGCTGTATGCGTCAACCAATGCGCCCGGCGTGGCAGCAGAGCTCATACTTGCT
ACCTTGAACACCAACGTACACGTCTACCAAGTGTCCCCTGCGCTGACGGTCATTGAGAAATATACCGGCCAGCGG
TTGGCGAACCTCTTCGGGCTGAACGGTCCACAGGCGGGAGGCATTTCCGTGCAGGGCGGATCCGCATCGAACACC
ACCTCCATTGTCATTGCGCGAAACAACCTATACCCCAGCACGAAGACAGACGGGAACGGCGGGTACAAGTTCGTG
CTCTTCACGAGCGCACACGGCCACTACAGCGTGGAAAAGGCAGCGCAGATGCTCGGGTTCGGCAGCAGTGCTGTC
TGGCCTGTTCCTGTTGACAAGGTCGGCCGCATGATCCCAGCCGAGCTTGAGAAACTGGTTCAGAAGGCGCAGAGC
GAAGGCCGGACGCCGTTCTATGTCAATGCCACCGCAGGCACAACCGTCCTAGGCTCTTTCGACCCCTTCAACGAA
ATCGCAGCCATTTGCGAAAAATACAACCTGTGGTTCCACATTGACGGATCCTGGGGTGGCTCGTTCGTTTTCTCC
CAGCGCCAGAAGCATAAGCTAGCTGGCGCAGAGAAAGCAAACAGCATCGGCATTAATCCGCACAAAATGCTTGGC
GTTCCGGTCACCTGCTCTTACCTGCTAGCCTCGGATATACGCCAGTTCCACAAGGCCAACACACTTCCCGCGGGG
TACCTATTCCACAGCGAAGAAGACGAGCCCGCTACCAACGGCGACGCAAACAAAGAATCCGAGTTGGAAGTCGAC
TCACCGGAAGTGTGGGATCTAGCAGACCTCACTCTCCAATGTGGTCGACGTGCGGATTCGTTGAAGCTGTTTTTG
GGTTGGACATACTATGGCAATGAGGGCTACCGACAGCAGATCGACTCGGCATGCGACATCGCTGCGCACTTGGCT
AATACCATCGCGCAACATCCTGATTTCGTTCTTATTAGCGAAAACCCTCCGCCCTGTCTGCAGGTGTGCTTTTAC
TACGCGCCAGGCAAGAAGTTCGTGTACCCGCGTGGCATCGTCTCGAATGAGACACAGCGCGGGAAGAATAACAGC
AAGGTCACTGAGCAGGTGACGCGTGCAATCGTGCCCAAGGGCTTCATGGTGGACTTTGCGCCTCCCAGTGGAGAG
GAGGACGAGGATGCAGCTGGGAATGGGAAGTTCTTCCGGTGCGTGGTGAATGTCCAGACGACGAAGGAGACCGTT
GATTCGCTTATCCGCGCCATCGAAGAGGTGGGTCCTGGTATTATTGAGTCTTTGAAGGCGAGCAACCCGGCGCTT
CCGCACAAGCGGCCTGGTGAGCGTGGACACGGACCTGTTGTCCATCGCGCTTGA
Gene >Pro_DTO377G3_2|g7763.t1
ATGTCTGGCATTGCGCAGCCCAATCGCGCTGATGAAGTGCAAAGTGTGAGTCAACTCTATATCGCAATGATCTAC
ACCCCACCAGATTCTTTATTCGATGTTCTGAAACTAATGCGAGCACCATGCTCAGCTTCTGAAAGCGGTGGAAGA
CCTTCTCATCCCCTTTATCCGATCCGCAGACGAGGATCCCCGCGGGTCCTTGACACAGAAAAATGGCACCAACGG
CACCAATGGACACACTGGACTCGTTGGAACCTCATTGATAGATTATAAGAAGCCTGAAGAGCTGCAGGATATCCT
TCAGCTTGAGATCCCAGAGAAAGGCACCAAGCAGGAAGGTCTCATTGAAGTCTTGAAAAAGGTTCTGCAATACTC
GGTCAACACCTGGCACCAGGGATTTTTGGACAAGCTGTATGCGTCAACCAATGCGCCCGGCGTGGCAGCAGAGCT
CATACTTGCTACCTTGAACACCAACGTACACGTCTACCAAGTGTCCCCTGCGCTGACGGTCATTGAGAAATATAC
CGGCCAGCGGTTGGCGAACCTCTTCGGGCTGAACGGTCCACAGGCGGGAGGCATTTCCGTGCAGGGCGGATCCGC
ATCGAACACCACCTCCATTGTCATTGCGCGAAACAACCTATACCCCAGCACGAAGACAGACGGGAACGGCGGGTA
CAAGTTCGTGCTCTTCACGAGCGCACACGGCCACTACAGCGTGGAAAAGGCAGCGCAGATGCTCGGGTTCGGCAG
CAGTGCTGTCTGGCCTGTTCCTGTTGACAAGGTCGGCCGCATGATCCCAGCCGAGCTTGAGAAACTGGTTCAGAA
GGCGCAGAGCGAAGGCCGGACGCCGTTCTATGTCAATGCCACCGCAGGCACAACCGTCCTAGGCTCTTTCGACCC
CTTCAACGAAATCGCAGCCATTTGCGAAAAATACAACCTGTGGTTCCACATTGACGGATCCTGGGGTGGCTCGTT
CGTTTTCTCCCAGCGCCAGAAGCATAAGCTAGCTGGCGCAGAGAAAGCAAACAGCATCGGCATTAATCCGCACAA
AATGCTTGGCGTTCCGGTCACCTGCTCTTACCTGCTAGCCTCGGATATACGCCAGTTCCACAAGGCCAACACACT
TCCCGCGGGGTACCTATTCCACAGCGAAGAAGACGAGCCCGCTACCAACGGCGACGCAAACAAAGAATCCGAGTT
GGAAGTCGACTCACCGGAAGTGTGGGATCTAGCAGACCTCACTCTCCAATGTGGTCGACGTGCGGATTCGTTGAA
GCTGTTTTTGGGTTGGACATACTATGGCAATGAGGGCTACCGACAGCAGATCGACTCGGCATGCGACATCGCTGC
GCACTTGGCTAATACCATCGCGCAACATCCTGATTTCGTTCTTATTAGCGAAAACCCTCCGCCCTGTCTGCAGGT
GTGCTTTTACTACGCGCCAGGCAAGAAGTTCGTGTACCCGCGTGGCATCGTCTCGAATGAGACACAGCGCGGGAA
GAATAACAGCAAGGTCACTGAGCAGGTGACGCGTGCAATCGTGCCCAAGGGCTTCATGGTGGACTTTGCGCCTCC
CAGTGGAGAGGAGGACGAGGATGCAGCTGGGAATGGGAAGTTCTTCCGGTGCGTGGTGAATGTCCAGACGACGAA
GGAGACCGTTGATTCGCTTATCCGCGCCATCGAAGAGGTGGGTCCTGGTATTATTGAGTCTTTGAAGGCGAGCAA
CCCGGCGCTTCCGCACAAGCGGCCTGGTGAGCGTGGACACGGACCTGTTGTCCATCGCGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail