Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7758.t1
Gene name
Locationscaffold_26:1513..3923
Strand-
Gene length (bp)2410
Transcript length (bp)2166
Coding sequence length (bp)2166
Protein length (aa) 722

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04516 CP2 CP2 transcription factor 5.9E-80 219 438

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CP2

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 124.48 74.68 174.27
5d_25C Five days - 25 degrees Celsius 186.98 109.03 264.93
7d_25C Seven days - 25 degrees Celsius 220.81 127.44 314.17
10d_25C Ten days - 25 degrees Celsius 348.26 191.36 505.15
7d_15C Seven days - 15 degrees Celsius 143.73 83.77 203.70
7d_30C Seven days - 30 degrees Celsius 224.50 127.06 321.94

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.057236 no
3d_25C 7d_25C 0.006000 yes
3d_25C 7d_15C 0.608970 no
3d_25C 7d_30C 0.005626 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.550657 no
5d_25C 7d_15C 0.283629 no
5d_25C 7d_30C 0.506128 no
5d_25C 10d_25C 0.004450 yes
7d_25C 7d_15C 0.054049 no
7d_25C 7d_30C 0.967504 no
7d_25C 10d_25C 0.052761 no
7d_15C 7d_30C 0.045756 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.063859 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7758.t1
MFTNRNNTQKPDGEFISRFQQTFSDIVPRRDSTSPRNVRAGEPLIAGLAENNDVKMEGHDVKLPITNNDRTPRNM
HELGLTPSWMESASYSMMPLANPHSGFYTPTSSGMGAMFHNQAGDLHTPTGMHLMTPLAGMPAVHNHHSTGFEPF
HPQFMNSVHGMNPYTQPSYAPSAFMHRDTGYDVMDDTLDDSSLNDVRVETASNVTASTEFSSQLAGDMSYAKGEK
FRFNVSLRAPTAMVKTLSEIPVTYLNKGQAYNLSVVDTSPPMLSHEPVRYRTFIRISFEEREQRARPSACWQLWK
EGRGTTEAHQRGGKLLAVEYVDPLQGGSDAHRNRQVQVESMSVDGFCVTWTANPATGISDCNIPVRFNFLSTDFS
HSKGVKGIPVRLCAKTELLSPDEETGLSHDPELSYCKVKLFRDHGAERKLSNDVAHVKKTIDKLKQQVSQAEMGG
GFSKRKRGSNFSGTSKGSDNSLKPSGHKRTWSMDSENTSEKVSLEDDLQAKLSTMQEMFSSTRSVSVFGLRGDNF
DDPDLYPIQLSGDSDSSQYGNTSRSSTRELESIMPSPPNTNTSSSNSPPTHALRLGKCPTTIQRVPSGDQISRGF
IEAIGVDLTYRPPSEHPLKPIACFYVRFTGNVTRSEDYYRAIYLTERTVRDLVKQITEKYHIDPMRISNIMHAHE
KGLRVIVDDDVVRQLPEGQDMIVDISEAPGGVSGTPESPMEINLTY*
Coding >Pro_DTO377G3_2|g7758.t1
ATGTTCACCAACCGGAACAACACCCAGAAGCCGGATGGTGAGTTCATCAGTCGCTTCCAGCAGACATTCTCAGAC
ATTGTCCCTCGGCGGGACAGCACGAGTCCGCGCAATGTGAGGGCAGGTGAACCTTTGATAGCAGGACTGGCCGAG
AATAACGATGTGAAAATGGAGGGTCATGATGTCAAGCTTCCCATCACTAACAACGACCGCACTCCCCGAAATATG
CATGAACTGGGCTTGACGCCCTCATGGATGGAATCCGCTTCCTATTCAATGATGCCTCTTGCCAACCCGCATTCG
GGCTTTTATACTCCAACCTCTTCTGGAATGGGTGCCATGTTCCATAATCAGGCGGGCGATTTGCATACCCCAACG
GGGATGCACTTGATGACCCCGTTGGCGGGCATGCCGGCTGTACACAATCACCACAGCACTGGCTTCGAGCCCTTC
CATCCGCAGTTCATGAATTCAGTGCATGGCATGAACCCGTACACACAGCCATCATATGCGCCAAGCGCATTCATG
CACCGCGACACCGGATATGATGTCATGGATGATACTCTCGATGACTCTTCTTTAAATGATGTACGTGTTGAAACA
GCATCCAATGTAACCGCCTCTACGGAATTTTCCTCTCAATTGGCTGGTGACATGTCATATGCCAAGGGCGAAAAA
TTCCGCTTCAATGTTTCTCTACGAGCACCGACCGCCATGGTGAAGACTCTAAGTGAAATTCCCGTGACCTATCTC
AATAAAGGCCAAGCCTACAATCTCTCAGTTGTCGATACAAGCCCACCAATGCTCAGCCACGAACCGGTCCGATAC
AGAACATTCATCCGAATTTCCTTCGAAGAGCGAGAACAACGGGCGAGACCGTCAGCATGTTGGCAACTATGGAAG
GAAGGCCGTGGTACCACAGAAGCCCATCAACGGGGCGGGAAATTATTGGCAGTTGAATACGTGGATCCATTACAA
GGGGGCAGTGACGCACACAGGAATCGACAGGTTCAAGTCGAGAGTATGTCAGTTGACGGCTTCTGCGTCACTTGG
ACTGCCAACCCAGCGACCGGCATATCAGATTGCAATATTCCCGTGCGGTTCAATTTCCTTTCCACAGATTTCAGC
CACTCAAAAGGCGTCAAGGGAATTCCTGTTAGACTGTGCGCTAAAACCGAGCTGTTGTCCCCGGACGAGGAGACC
GGTCTCTCGCACGATCCAGAGCTGTCTTACTGCAAAGTCAAACTTTTCCGGGATCATGGTGCGGAGCGGAAGCTG
TCGAACGACGTCGCGCATGTTAAGAAGACCATTGATAAGCTTAAACAGCAAGTCTCCCAGGCAGAAATGGGTGGT
GGATTTTCGAAGCGCAAACGGGGAAGTAATTTCTCGGGCACCTCCAAGGGATCGGATAATTCATTGAAGCCTTCG
GGCCACAAGCGAACTTGGTCGATGGACTCGGAAAATACTTCAGAGAAAGTTTCCTTAGAGGACGACCTTCAAGCC
AAGTTGTCTACGATGCAAGAGATGTTCTCATCTACTCGCTCAGTGAGCGTTTTCGGTTTACGCGGTGACAACTTC
GACGATCCGGACCTATATCCGATCCAGTTATCAGGTGATAGCGATTCCTCTCAGTATGGGAATACAAGTCGTTCA
AGCACACGTGAATTAGAGTCTATCATGCCTTCGCCACCGAACACCAATACCTCTTCTTCGAATTCGCCGCCTACC
CACGCACTCAGATTAGGAAAATGCCCCACCACTATCCAGAGGGTTCCTTCCGGCGACCAAATCTCAAGGGGTTTC
ATAGAGGCCATCGGTGTAGACTTGACCTACCGACCTCCGTCGGAACACCCTCTCAAGCCAATTGCATGCTTCTAT
GTTCGATTCACTGGAAATGTGACGCGCTCAGAGGATTACTACCGTGCAATCTATTTGACAGAACGCACCGTTCGA
GACCTCGTGAAGCAAATCACCGAGAAATATCACATCGATCCGATGCGGATCTCAAATATCATGCATGCCCATGAG
AAAGGCCTGCGAGTTATAGTTGATGACGATGTGGTCCGCCAGCTTCCAGAGGGTCAAGACATGATCGTCGACATA
TCCGAAGCACCCGGCGGTGTTTCTGGCACACCCGAATCTCCTATGGAGATCAACTTAACTTATTAA
Transcript >Pro_DTO377G3_2|g7758.t1
ATGTTCACCAACCGGAACAACACCCAGAAGCCGGATGGTGAGTTCATCAGTCGCTTCCAGCAGACATTCTCAGAC
ATTGTCCCTCGGCGGGACAGCACGAGTCCGCGCAATGTGAGGGCAGGTGAACCTTTGATAGCAGGACTGGCCGAG
AATAACGATGTGAAAATGGAGGGTCATGATGTCAAGCTTCCCATCACTAACAACGACCGCACTCCCCGAAATATG
CATGAACTGGGCTTGACGCCCTCATGGATGGAATCCGCTTCCTATTCAATGATGCCTCTTGCCAACCCGCATTCG
GGCTTTTATACTCCAACCTCTTCTGGAATGGGTGCCATGTTCCATAATCAGGCGGGCGATTTGCATACCCCAACG
GGGATGCACTTGATGACCCCGTTGGCGGGCATGCCGGCTGTACACAATCACCACAGCACTGGCTTCGAGCCCTTC
CATCCGCAGTTCATGAATTCAGTGCATGGCATGAACCCGTACACACAGCCATCATATGCGCCAAGCGCATTCATG
CACCGCGACACCGGATATGATGTCATGGATGATACTCTCGATGACTCTTCTTTAAATGATGTACGTGTTGAAACA
GCATCCAATGTAACCGCCTCTACGGAATTTTCCTCTCAATTGGCTGGTGACATGTCATATGCCAAGGGCGAAAAA
TTCCGCTTCAATGTTTCTCTACGAGCACCGACCGCCATGGTGAAGACTCTAAGTGAAATTCCCGTGACCTATCTC
AATAAAGGCCAAGCCTACAATCTCTCAGTTGTCGATACAAGCCCACCAATGCTCAGCCACGAACCGGTCCGATAC
AGAACATTCATCCGAATTTCCTTCGAAGAGCGAGAACAACGGGCGAGACCGTCAGCATGTTGGCAACTATGGAAG
GAAGGCCGTGGTACCACAGAAGCCCATCAACGGGGCGGGAAATTATTGGCAGTTGAATACGTGGATCCATTACAA
GGGGGCAGTGACGCACACAGGAATCGACAGGTTCAAGTCGAGAGTATGTCAGTTGACGGCTTCTGCGTCACTTGG
ACTGCCAACCCAGCGACCGGCATATCAGATTGCAATATTCCCGTGCGGTTCAATTTCCTTTCCACAGATTTCAGC
CACTCAAAAGGCGTCAAGGGAATTCCTGTTAGACTGTGCGCTAAAACCGAGCTGTTGTCCCCGGACGAGGAGACC
GGTCTCTCGCACGATCCAGAGCTGTCTTACTGCAAAGTCAAACTTTTCCGGGATCATGGTGCGGAGCGGAAGCTG
TCGAACGACGTCGCGCATGTTAAGAAGACCATTGATAAGCTTAAACAGCAAGTCTCCCAGGCAGAAATGGGTGGT
GGATTTTCGAAGCGCAAACGGGGAAGTAATTTCTCGGGCACCTCCAAGGGATCGGATAATTCATTGAAGCCTTCG
GGCCACAAGCGAACTTGGTCGATGGACTCGGAAAATACTTCAGAGAAAGTTTCCTTAGAGGACGACCTTCAAGCC
AAGTTGTCTACGATGCAAGAGATGTTCTCATCTACTCGCTCAGTGAGCGTTTTCGGTTTACGCGGTGACAACTTC
GACGATCCGGACCTATATCCGATCCAGTTATCAGGTGATAGCGATTCCTCTCAGTATGGGAATACAAGTCGTTCA
AGCACACGTGAATTAGAGTCTATCATGCCTTCGCCACCGAACACCAATACCTCTTCTTCGAATTCGCCGCCTACC
CACGCACTCAGATTAGGAAAATGCCCCACCACTATCCAGAGGGTTCCTTCCGGCGACCAAATCTCAAGGGGTTTC
ATAGAGGCCATCGGTGTAGACTTGACCTACCGACCTCCGTCGGAACACCCTCTCAAGCCAATTGCATGCTTCTAT
GTTCGATTCACTGGAAATGTGACGCGCTCAGAGGATTACTACCGTGCAATCTATTTGACAGAACGCACCGTTCGA
GACCTCGTGAAGCAAATCACCGAGAAATATCACATCGATCCGATGCGGATCTCAAATATCATGCATGCCCATGAG
AAAGGCCTGCGAGTTATAGTTGATGACGATGTGGTCCGCCAGCTTCCAGAGGGTCAAGACATGATCGTCGACATA
TCCGAAGCACCCGGCGGTGTTTCTGGCACACCCGAATCTCCTATGGAGATCAACTTAACTTATTAA
Gene >Pro_DTO377G3_2|g7758.t1
ATGTTCACCAACCGGTGAGTTTGTCGCCGCTTAACTTGGTCAATCGTATAATGGTCTGTTCTAACGTTCAAGTTC
GCGCAACAGGAACAACACCCAGAAGCCGGATGGTGAGTTCATCAGTCGCTTCCAGCAGACATTCTCAGACATTGT
CCCTCGGCGGGACAGCACGAGTCCGCGCAATGTGAGGGCAGGTGAACCTTTGATAGCAGGGTATGTACATTATAT
TCTACCAGGTAAAATGTCCGAGGTCAGAAACTGACATTCTTGCATAGACTGGCCGAGAATAACGATGTGAAAATG
GAGGGTCATGATGTCAAGCTTCCCATCACTAACAACGACCGCACTCCCCGAAATATGCATGAACTGGGCTTGACG
CCCTCATGGATGGAATCCGCTTCCTATTCAATGATGCCTCTTGCCAACCCGCATTCGGGCTTTTATACTCCAACC
TCTTCTGGAATGGGTGCCATGTTCCATAATCAGGCGGGCGATTTGCATACCCCAACGGGGATGCACTTGATGACC
CCGTTGGCGGGCATGCCGGCTGTACACAATCACCACAGCACTGGCTTCGAGCCCTTCCATCCGCAGTTCATGAAT
TCAGTGCATGGCATGAACCCGTACACACAGCCATCATATGCGCCAAGCGCATTCATGCACCGCGACACCGGATAT
GATGTCATGGATGATACTCTCGATGACTCTTCTTTAAATGATGTACGTGTTGAAACAGCATCCAATGTAACCGCC
TCTACGGAATTTTCCTCTCAATTGGCTGGTGACATGTCATATGCCAAGGGCGAAAAGTGAGTTTAATGATCCAAA
TAGTAAATGTCCGTTCAATCCTAACCAGGTTCGCACTCATAGATTCCGCTTCAATGTTTCTCTACGAGCACCGAC
CGCCATGGTGAAGACTCTAAGTGAAATTCCCGTGACCTATCTCAATAAAGGCCAAGCCTACAATCTCTCAGTTGT
CGATACAAGCCCACCAATGCTCAGCCACGAACCGGTCCGATACAGAACATTCATCCGAATTTCCTTCGAAGAGCG
AGAACAACGGGCGAGACCGTCAGCATGTTGGCAACTATGGAAGGAAGGCCGTGGTACCACAGAAGCCCATCAACG
GGGCGGGAAATTATTGGCAGTTGAATACGTGGATCCATTACAAGGGGGCAGTGACGCACACAGGAATCGACAGGT
TCAAGTCGAGAGTATGTCAGTTGACGGCTTCTGCGTCACTTGGACTGCCAACCCAGCGACCGGCATATCAGATTG
CAATATTCCCGTGCGGTTCAATTTCCTTTCCACAGATTTCAGCCACTCAAAAGGCGTCAAGGGAATTCCTGTTAG
ACTGTGCGCTAAAACCGAGCTGTTGTCCCCGGACGAGGAGACCGGTCTCTCGCACGATCCAGAGCTGTCTTACTG
CAAAGTCAAACTTTTCCGGGATCATGGTGCGGAGCGGAAGCTGTCGAACGACGTCGCGCATGTTAAGAAGACCAT
TGATAAGCTTAAACAGCAAGTCTCCCAGGCAGAAATGGGTGGTGGATTTTCGAAGCGCAAACGGGGAAGTAATTT
CTCGGGCACCTCCAAGGGATCGGATAATTCATTGAAGCCTTCGGGCCACAAGCGAACTTGGTCGATGGACTCGGA
AAATACTTCAGAGAAAGTTTCCTTAGAGGACGACCTTCAAGCCAAGTTGTCTACGATGCAAGAGATGTTCTCATC
TACTCGCTCAGTGAGCGTTTTCGGTTTACGCGGTGACAACTTCGACGATCCGGACCTATATCCGATCCAGTTATC
AGGTGATAGCGATTCCTCTCAGTATGGGAATACAAGTCGTTCAAGCACACGTGAATTAGAGTCTATCATGCCTTC
GCCACCGAACACCAATACCTCTTCTTCGAATTCGCCGCCTACCCACGCACTCAGATTAGGAAAATGCCCCACCAC
TATCCAGAGGGTTCCTTCCGGCGACCAAATCTCAAGGGGTTTCATAGAGGCCATCGGTGTAGACTTGACCTACCG
ACCTCCGTCGGAACACCCTCTCAAGCCAAGTGAGTTTCTCGCGCGCAACCCGTCAATATTTTTGCTAATTTTCTT
CGCAGTTGCATGCTTCTATGTTCGATTCACTGGAAATGTGACGCGCTCAGAGGATTACTACCGTGCAATCTATTT
GACAGAACGCACCGTTCGAGACCTCGTGAAGCAAATCACCGAGAAATATCACATCGATCCGATGCGGATCTCAAA
TATCATGCATGCCCATGAGAAAGGCCTGCGAGTTATAGTTGATGACGATGTGGTCCGCCAGCTTCCAGAGGGTCA
AGACATGATCGTCGACATATCCGAAGCACCCGGCGGTGTTTCTGGCACACCCGAATCTCCTATGGAGATCAACTT
AACTTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail