Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7742.t1
Gene name
Locationscaffold_25:281402..283679
Strand+
Gene length (bp)2277
Transcript length (bp)2277
Coding sequence length (bp)2277
Protein length (aa) 759

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06046 Sec6 Exocyst complex component Sec6 4.6E-169 183 757

GO

GO Term Description Terminal node
GO:0000145 exocyst Yes
GO:0006887 exocytosis Yes
GO:0006810 transport No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0099023 tethering complex No
GO:0044448 cell cortex part No
GO:0051179 localization No
GO:0032940 secretion by cell No
GO:0044424 intracellular part No
GO:0005575 cellular_component No
GO:0046903 secretion No
GO:0032991 protein-containing complex No
GO:0016192 vesicle-mediated transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7742.t1
MTQASNIDATVALPRLEDLLRHPEDLDKISGLKAEYLRKKTAVDSRLREGLRDQLEAVQRSIGALTEGQRQVSKT
KDELQGIDKLCAESQHSVEDFAQIDQLARIQRHFDATLMMKRGLENFGADIQEVEDLLREDDDDMENQPNILRAH
MQISRLRDFRDEAMDQIRKAEDQSSEETLTEYFEGLDSVIEWFDDHLGTACMNLIPLVQADNKSMVVRLAVVVLN
EEKNDDTVRALQEAQKDHKDLASRFKSMNIGPKTVRGYKDKFIQAIELYAQSQFEETLENFLGDPDNLEKKFRWY
FNDLFTVKQGMQSLVPKKWKIFKTYTDIYHRMMHDFLLSMIDDPELPADNLLSIIHWSDKYYKKMKKLGWTPTDL
QANILDDREPELVRKWQAVIINAVEEWMDRIFNADKKSLVERVSDALDNNAEGHFRTKTLADMWRMLHEQVMASG
ASDRADLVEGIIDAIFRALKARQIAWQALVDEECAKHQVEGADQEGVQLLQDWLIGIANDQISCIDDNEEDNQFG
YLTRFKSDFEPMVTPKYMGTTATIELDALRDGYVDLSTHCLAQFVSLIFWVDLDTVLPDFFTSRWYGEFAMKRIT
STFEDYMADYASVLHPSLAEILVEELSDELLVRYLSAVRNKGVKFRRHIDPFTDKFKDDVLTVFAFFENYPDSFE
GTIKQKWRLVDWLVRLLATEKGPALVEVYEAFKLEYWDLQLSWVEAVLRTRDDFERSMLTAIKAKAAELSVERGQ
ETIMSRLR*
Coding >Pro_DTO377G3_2|g7742.t1
ATGACGCAAGCCAGTAACATTGATGCCACGGTCGCTCTGCCGCGACTCGAAGACCTCCTACGGCACCCGGAGGAT
CTAGACAAGATCAGCGGGCTTAAAGCGGAATACCTGCGGAAGAAGACGGCAGTTGATTCCCGGTTGCGTGAAGGT
CTGCGAGACCAGCTGGAGGCCGTACAACGTAGCATTGGTGCTTTGACTGAGGGCCAGCGACAAGTCTCGAAGACA
AAAGACGAGCTACAAGGCATCGACAAGCTATGCGCCGAGTCGCAGCATAGCGTGGAGGACTTTGCGCAGATTGAC
CAACTTGCGCGGATTCAAAGACATTTCGATGCTACGCTCATGATGAAACGAGGACTGGAGAATTTCGGCGCGGAT
ATCCAGGAAGTGGAGGATTTGCTCAGAGAGGATGATGACGATATGGAGAATCAGCCTAATATTCTGCGGGCTCAT
ATGCAGATATCACGGTTAAGGGATTTCCGTGATGAGGCTATGGATCAGATTCGCAAGGCGGAGGATCAGAGCTCC
GAAGAGACTCTGACAGAGTACTTTGAGGGGTTGGATTCTGTTATTGAGTGGTTCGATGATCACCTTGGCACGGCT
TGCATGAACCTCATTCCATTGGTGCAGGCAGACAACAAGAGTATGGTCGTGCGACTTGCTGTTGTTGTCTTGAAC
GAGGAGAAAAATGATGATACAGTTCGAGCGTTGCAAGAGGCCCAGAAAGACCACAAGGACCTTGCAAGTCGTTTC
AAGTCCATGAACATTGGCCCCAAGACTGTGCGGGGCTACAAGGACAAATTCATCCAGGCTATCGAGCTTTACGCC
CAAAGCCAATTCGAAGAGACCCTCGAAAACTTTCTTGGAGACCCAGACAATCTGGAAAAGAAGTTCCGGTGGTAC
TTCAATGATCTATTCACGGTCAAGCAAGGCATGCAGAGCCTTGTACCGAAGAAATGGAAGATATTCAAAACATAC
ACCGATATCTATCATCGGATGATGCATGACTTCTTGCTTAGCATGATCGACGACCCCGAGCTCCCGGCTGATAAT
TTACTCAGTATCATTCACTGGAGTGACAAGTACTACAAGAAAATGAAGAAGCTGGGCTGGACACCAACAGATCTC
CAAGCCAACATTCTCGACGACCGCGAGCCAGAACTAGTCCGAAAGTGGCAGGCCGTCATCATCAATGCCGTCGAA
GAATGGATGGACCGCATTTTCAACGCGGACAAAAAGTCTCTGGTAGAGCGTGTCTCAGATGCCCTAGACAACAAC
GCAGAAGGTCACTTTCGCACCAAGACACTGGCCGACATGTGGCGCATGCTCCACGAACAAGTTATGGCATCAGGA
GCATCAGACCGCGCAGACCTGGTAGAGGGTATCATTGATGCCATTTTCCGAGCCTTGAAGGCCCGACAAATTGCA
TGGCAGGCACTCGTGGACGAGGAATGTGCGAAGCACCAAGTAGAAGGCGCAGACCAAGAAGGCGTGCAGCTGTTG
CAAGACTGGCTGATCGGAATAGCCAACGATCAAATCTCCTGCATCGACGACAACGAGGAGGACAACCAGTTCGGC
TACCTGACGCGGTTCAAGTCCGATTTCGAGCCCATGGTCACACCCAAGTACATGGGCACCACAGCAACCATCGAG
CTGGATGCACTGCGCGATGGCTATGTTGATCTGAGCACGCACTGCCTGGCGCAGTTCGTGAGCCTGATCTTCTGG
GTCGATCTGGACACTGTCCTGCCAGACTTCTTCACGTCCCGCTGGTACGGCGAATTTGCCATGAAGCGTATCACT
TCCACCTTCGAAGACTACATGGCGGACTACGCCTCCGTGCTGCACCCATCTTTGGCCGAGATCCTGGTCGAGGAA
CTCTCGGACGAGCTGCTGGTGCGCTACCTCTCTGCGGTGCGAAACAAGGGTGTTAAATTCCGCCGCCATATCGAC
CCTTTCACAGACAAGTTCAAGGACGACGTTCTCACTGTATTCGCGTTCTTTGAAAACTACCCCGACTCATTTGAG
GGTACTATCAAGCAGAAGTGGCGGCTGGTTGATTGGCTTGTTCGCCTCCTTGCCACTGAAAAGGGCCCCGCGCTC
GTGGAGGTTTATGAAGCATTCAAGCTTGAGTACTGGGACCTGCAGCTTTCATGGGTTGAGGCTGTGCTGCGTACC
CGTGATGATTTCGAGCGCAGCATGCTCACTGCCATCAAGGCTAAAGCCGCGGAGTTGTCTGTTGAACGGGGACAG
GAGACCATCATGAGTCGGTTGAGATGA
Transcript >Pro_DTO377G3_2|g7742.t1
ATGACGCAAGCCAGTAACATTGATGCCACGGTCGCTCTGCCGCGACTCGAAGACCTCCTACGGCACCCGGAGGAT
CTAGACAAGATCAGCGGGCTTAAAGCGGAATACCTGCGGAAGAAGACGGCAGTTGATTCCCGGTTGCGTGAAGGT
CTGCGAGACCAGCTGGAGGCCGTACAACGTAGCATTGGTGCTTTGACTGAGGGCCAGCGACAAGTCTCGAAGACA
AAAGACGAGCTACAAGGCATCGACAAGCTATGCGCCGAGTCGCAGCATAGCGTGGAGGACTTTGCGCAGATTGAC
CAACTTGCGCGGATTCAAAGACATTTCGATGCTACGCTCATGATGAAACGAGGACTGGAGAATTTCGGCGCGGAT
ATCCAGGAAGTGGAGGATTTGCTCAGAGAGGATGATGACGATATGGAGAATCAGCCTAATATTCTGCGGGCTCAT
ATGCAGATATCACGGTTAAGGGATTTCCGTGATGAGGCTATGGATCAGATTCGCAAGGCGGAGGATCAGAGCTCC
GAAGAGACTCTGACAGAGTACTTTGAGGGGTTGGATTCTGTTATTGAGTGGTTCGATGATCACCTTGGCACGGCT
TGCATGAACCTCATTCCATTGGTGCAGGCAGACAACAAGAGTATGGTCGTGCGACTTGCTGTTGTTGTCTTGAAC
GAGGAGAAAAATGATGATACAGTTCGAGCGTTGCAAGAGGCCCAGAAAGACCACAAGGACCTTGCAAGTCGTTTC
AAGTCCATGAACATTGGCCCCAAGACTGTGCGGGGCTACAAGGACAAATTCATCCAGGCTATCGAGCTTTACGCC
CAAAGCCAATTCGAAGAGACCCTCGAAAACTTTCTTGGAGACCCAGACAATCTGGAAAAGAAGTTCCGGTGGTAC
TTCAATGATCTATTCACGGTCAAGCAAGGCATGCAGAGCCTTGTACCGAAGAAATGGAAGATATTCAAAACATAC
ACCGATATCTATCATCGGATGATGCATGACTTCTTGCTTAGCATGATCGACGACCCCGAGCTCCCGGCTGATAAT
TTACTCAGTATCATTCACTGGAGTGACAAGTACTACAAGAAAATGAAGAAGCTGGGCTGGACACCAACAGATCTC
CAAGCCAACATTCTCGACGACCGCGAGCCAGAACTAGTCCGAAAGTGGCAGGCCGTCATCATCAATGCCGTCGAA
GAATGGATGGACCGCATTTTCAACGCGGACAAAAAGTCTCTGGTAGAGCGTGTCTCAGATGCCCTAGACAACAAC
GCAGAAGGTCACTTTCGCACCAAGACACTGGCCGACATGTGGCGCATGCTCCACGAACAAGTTATGGCATCAGGA
GCATCAGACCGCGCAGACCTGGTAGAGGGTATCATTGATGCCATTTTCCGAGCCTTGAAGGCCCGACAAATTGCA
TGGCAGGCACTCGTGGACGAGGAATGTGCGAAGCACCAAGTAGAAGGCGCAGACCAAGAAGGCGTGCAGCTGTTG
CAAGACTGGCTGATCGGAATAGCCAACGATCAAATCTCCTGCATCGACGACAACGAGGAGGACAACCAGTTCGGC
TACCTGACGCGGTTCAAGTCCGATTTCGAGCCCATGGTCACACCCAAGTACATGGGCACCACAGCAACCATCGAG
CTGGATGCACTGCGCGATGGCTATGTTGATCTGAGCACGCACTGCCTGGCGCAGTTCGTGAGCCTGATCTTCTGG
GTCGATCTGGACACTGTCCTGCCAGACTTCTTCACGTCCCGCTGGTACGGCGAATTTGCCATGAAGCGTATCACT
TCCACCTTCGAAGACTACATGGCGGACTACGCCTCCGTGCTGCACCCATCTTTGGCCGAGATCCTGGTCGAGGAA
CTCTCGGACGAGCTGCTGGTGCGCTACCTCTCTGCGGTGCGAAACAAGGGTGTTAAATTCCGCCGCCATATCGAC
CCTTTCACAGACAAGTTCAAGGACGACGTTCTCACTGTATTCGCGTTCTTTGAAAACTACCCCGACTCATTTGAG
GGTACTATCAAGCAGAAGTGGCGGCTGGTTGATTGGCTTGTTCGCCTCCTTGCCACTGAAAAGGGCCCCGCGCTC
GTGGAGGTTTATGAAGCATTCAAGCTTGAGTACTGGGACCTGCAGCTTTCATGGGTTGAGGCTGTGCTGCGTACC
CGTGATGATTTCGAGCGCAGCATGCTCACTGCCATCAAGGCTAAAGCCGCGGAGTTGTCTGTTGAACGGGGACAG
GAGACCATCATGAGTCGGTTGAGATGA
Gene >Pro_DTO377G3_2|g7742.t1
ATGACGCAAGCCAGTAACATTGATGCCACGGTCGCTCTGCCGCGACTCGAAGACCTCCTACGGCACCCGGAGGAT
CTAGACAAGATCAGCGGGCTTAAAGCGGAATACCTGCGGAAGAAGACGGCAGTTGATTCCCGGTTGCGTGAAGGT
CTGCGAGACCAGCTGGAGGCCGTACAACGTAGCATTGGTGCTTTGACTGAGGGCCAGCGACAAGTCTCGAAGACA
AAAGACGAGCTACAAGGCATCGACAAGCTATGCGCCGAGTCGCAGCATAGCGTGGAGGACTTTGCGCAGATTGAC
CAACTTGCGCGGATTCAAAGACATTTCGATGCTACGCTCATGATGAAACGAGGACTGGAGAATTTCGGCGCGGAT
ATCCAGGAAGTGGAGGATTTGCTCAGAGAGGATGATGACGATATGGAGAATCAGCCTAATATTCTGCGGGCTCAT
ATGCAGATATCACGGTTAAGGGATTTCCGTGATGAGGCTATGGATCAGATTCGCAAGGCGGAGGATCAGAGCTCC
GAAGAGACTCTGACAGAGTACTTTGAGGGGTTGGATTCTGTTATTGAGTGGTTCGATGATCACCTTGGCACGGCT
TGCATGAACCTCATTCCATTGGTGCAGGCAGACAACAAGAGTATGGTCGTGCGACTTGCTGTTGTTGTCTTGAAC
GAGGAGAAAAATGATGATACAGTTCGAGCGTTGCAAGAGGCCCAGAAAGACCACAAGGACCTTGCAAGTCGTTTC
AAGTCCATGAACATTGGCCCCAAGACTGTGCGGGGCTACAAGGACAAATTCATCCAGGCTATCGAGCTTTACGCC
CAAAGCCAATTCGAAGAGACCCTCGAAAACTTTCTTGGAGACCCAGACAATCTGGAAAAGAAGTTCCGGTGGTAC
TTCAATGATCTATTCACGGTCAAGCAAGGCATGCAGAGCCTTGTACCGAAGAAATGGAAGATATTCAAAACATAC
ACCGATATCTATCATCGGATGATGCATGACTTCTTGCTTAGCATGATCGACGACCCCGAGCTCCCGGCTGATAAT
TTACTCAGTATCATTCACTGGAGTGACAAGTACTACAAGAAAATGAAGAAGCTGGGCTGGACACCAACAGATCTC
CAAGCCAACATTCTCGACGACCGCGAGCCAGAACTAGTCCGAAAGTGGCAGGCCGTCATCATCAATGCCGTCGAA
GAATGGATGGACCGCATTTTCAACGCGGACAAAAAGTCTCTGGTAGAGCGTGTCTCAGATGCCCTAGACAACAAC
GCAGAAGGTCACTTTCGCACCAAGACACTGGCCGACATGTGGCGCATGCTCCACGAACAAGTTATGGCATCAGGA
GCATCAGACCGCGCAGACCTGGTAGAGGGTATCATTGATGCCATTTTCCGAGCCTTGAAGGCCCGACAAATTGCA
TGGCAGGCACTCGTGGACGAGGAATGTGCGAAGCACCAAGTAGAAGGCGCAGACCAAGAAGGCGTGCAGCTGTTG
CAAGACTGGCTGATCGGAATAGCCAACGATCAAATCTCCTGCATCGACGACAACGAGGAGGACAACCAGTTCGGC
TACCTGACGCGGTTCAAGTCCGATTTCGAGCCCATGGTCACACCCAAGTACATGGGCACCACAGCAACCATCGAG
CTGGATGCACTGCGCGATGGCTATGTTGATCTGAGCACGCACTGCCTGGCGCAGTTCGTGAGCCTGATCTTCTGG
GTCGATCTGGACACTGTCCTGCCAGACTTCTTCACGTCCCGCTGGTACGGCGAATTTGCCATGAAGCGTATCACT
TCCACCTTCGAAGACTACATGGCGGACTACGCCTCCGTGCTGCACCCATCTTTGGCCGAGATCCTGGTCGAGGAA
CTCTCGGACGAGCTGCTGGTGCGCTACCTCTCTGCGGTGCGAAACAAGGGTGTTAAATTCCGCCGCCATATCGAC
CCTTTCACAGACAAGTTCAAGGACGACGTTCTCACTGTATTCGCGTTCTTTGAAAACTACCCCGACTCATTTGAG
GGTACTATCAAGCAGAAGTGGCGGCTGGTTGATTGGCTTGTTCGCCTCCTTGCCACTGAAAAGGGCCCCGCGCTC
GTGGAGGTTTATGAAGCATTCAAGCTTGAGTACTGGGACCTGCAGCTTTCATGGGTTGAGGCTGTGCTGCGTACC
CGTGATGATTTCGAGCGCAGCATGCTCACTGCCATCAAGGCTAAAGCCGCGGAGTTGTCTGTTGAACGGGGACAG
GAGACCATCATGAGTCGGTTGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail