Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7739.t1
Gene name
Locationscaffold_25:275928..277567
Strand+
Gene length (bp)1639
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00682 HMGL-like HMGL-like 1.5E-78 63 322

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 206.60 124.82 288.38
5d_25C Five days - 25 degrees Celsius 159.86 97.57 222.16
7d_25C Seven days - 25 degrees Celsius 137.07 83.73 190.41
10d_25C Ten days - 25 degrees Celsius 104.75 63.90 145.60
7d_15C Seven days - 15 degrees Celsius 247.25 146.48 348.02
7d_30C Seven days - 30 degrees Celsius 126.58 77.04 176.11

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.277230 no
3d_25C 7d_25C 0.054965 no
3d_25C 7d_15C 0.492320 no
3d_25C 7d_30C 0.018838 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.561720 no
5d_25C 7d_15C 0.037779 yes
5d_25C 7d_30C 0.332474 no
5d_25C 10d_25C 0.043201 yes
7d_25C 7d_15C 0.003197 yes
7d_25C 7d_30C 0.794959 no
7d_25C 10d_25C 0.254816 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.461507 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7739.t1
MCTGADSEPNGQDNGAPGVIAPDGDHTGFVGIETRQNPHPSSSRNPYGHDAGVTDFLSNVSRFKIIESTLREGEQ
FANAFFDTAKKIEIAKALDDFGVDYIELTSPCASEQSRADCEAICKLGLKAKILTHIRCHMDDARIAVETGVDGV
DVVIGTSSYLREHSHGKDMTYIKNAAIEVIEFVKSKGIEIRFSSEDSFRSDLVDLLSIYSAVDKVGVNRVGIADT
VGCASPRQVYELVRVLRGVVGCDIETHFHNDTGCAIANAFCALEAGATHIDTSVLGIGERNGITPLGGLMARMMV
ADRDYVKGKYKLEKLKEIEDLVAEAVEVNIPFNNYITGFCAFTHKAGIHAKAILNNPSTYEIINPADFGMTRYVH
FASRLTGWNAIKSRAQQLKLEMTDAQYKECTAKIKAMADIRPIAVDDADSIIRAYHRNLKSGENKPLLDLSAEEQ
AAFAVKEKELLAAQAAGLAV*
Coding >Pro_DTO377G3_2|g7739.t1
ATGTGTACTGGTGCCGACTCCGAGCCCAATGGGCAAGACAATGGTGCTCCTGGCGTCATTGCTCCTGATGGCGAT
CACACTGGTTTTGTTGGCATTGAGACTCGCCAAAACCCACACCCCTCCTCATCTCGCAACCCCTACGGTCACGAC
GCTGGCGTCACCGATTTCCTTAGCAATGTCTCACGCTTCAAGATTATTGAGTCTACCTTGCGTGAGGGAGAGCAG
TTCGCCAACGCCTTCTTCGATACCGCCAAGAAGATCGAGATTGCCAAGGCTCTCGATGACTTCGGTGTAGACTAC
ATTGAACTCACAAGTCCCTGCGCTTCTGAGCAGTCCCGTGCGGATTGCGAGGCCATTTGCAAGCTTGGCCTGAAG
GCTAAGATTCTCACTCACATTCGCTGCCACATGGATGATGCCCGTATTGCTGTCGAGACCGGTGTTGATGGAGTT
GATGTTGTTATTGGTACTTCCTCTTACCTCCGTGAGCACTCTCACGGCAAGGACATGACCTACATCAAGAACGCC
GCCATTGAAGTTATCGAGTTCGTCAAGTCCAAGGGCATTGAGATCCGCTTCTCCAGTGAGGACTCTTTCCGTTCC
GACCTGGTTGACCTTCTGTCAATCTACTCCGCCGTGGACAAGGTTGGTGTGAACCGTGTTGGTATTGCCGACACC
GTTGGCTGCGCTTCCCCCCGCCAGGTTTACGAGCTCGTCCGTGTTCTGCGCGGTGTTGTTGGCTGTGACATCGAG
ACTCACTTCCACAATGACACTGGTTGTGCCATTGCCAATGCCTTCTGTGCCCTCGAGGCCGGTGCCACTCACATT
GATACCTCTGTTCTTGGTATCGGCGAGCGTAACGGTATCACCCCTCTCGGTGGCCTGATGGCCCGCATGATGGTC
GCCGACCGCGACTACGTCAAGGGCAAGTACAAGCTTGAGAAGCTCAAGGAGATTGAGGACCTCGTCGCCGAGGCC
GTTGAGGTCAACATTCCTTTCAACAACTACATCACCGGTTTCTGCGCCTTCACCCACAAGGCTGGTATCCACGCC
AAGGCCATCCTCAACAACCCCAGCACCTACGAGATTATCAACCCTGCCGATTTCGGCATGACCCGCTACGTCCAT
TTCGCCTCTCGTTTGACCGGATGGAACGCCATCAAGTCGCGTGCCCAGCAGCTCAAGCTTGAGATGACTGACGCT
CAATACAAGGAGTGCACTGCCAAGATTAAGGCTATGGCTGATATCCGTCCTATTGCCGTCGATGATGCCGACAGC
ATTATCCGTGCTTACCACCGTAACTTGAAGTCCGGCGAGAACAAGCCCCTTCTTGATCTGAGCGCCGAGGAGCAG
GCCGCATTCGCCGTCAAGGAGAAGGAGCTCCTTGCGGCTCAGGCTGCCGGTCTTGCGGTATAG
Transcript >Pro_DTO377G3_2|g7739.t1
ATGTGTACTGGTGCCGACTCCGAGCCCAATGGGCAAGACAATGGTGCTCCTGGCGTCATTGCTCCTGATGGCGAT
CACACTGGTTTTGTTGGCATTGAGACTCGCCAAAACCCACACCCCTCCTCATCTCGCAACCCCTACGGTCACGAC
GCTGGCGTCACCGATTTCCTTAGCAATGTCTCACGCTTCAAGATTATTGAGTCTACCTTGCGTGAGGGAGAGCAG
TTCGCCAACGCCTTCTTCGATACCGCCAAGAAGATCGAGATTGCCAAGGCTCTCGATGACTTCGGTGTAGACTAC
ATTGAACTCACAAGTCCCTGCGCTTCTGAGCAGTCCCGTGCGGATTGCGAGGCCATTTGCAAGCTTGGCCTGAAG
GCTAAGATTCTCACTCACATTCGCTGCCACATGGATGATGCCCGTATTGCTGTCGAGACCGGTGTTGATGGAGTT
GATGTTGTTATTGGTACTTCCTCTTACCTCCGTGAGCACTCTCACGGCAAGGACATGACCTACATCAAGAACGCC
GCCATTGAAGTTATCGAGTTCGTCAAGTCCAAGGGCATTGAGATCCGCTTCTCCAGTGAGGACTCTTTCCGTTCC
GACCTGGTTGACCTTCTGTCAATCTACTCCGCCGTGGACAAGGTTGGTGTGAACCGTGTTGGTATTGCCGACACC
GTTGGCTGCGCTTCCCCCCGCCAGGTTTACGAGCTCGTCCGTGTTCTGCGCGGTGTTGTTGGCTGTGACATCGAG
ACTCACTTCCACAATGACACTGGTTGTGCCATTGCCAATGCCTTCTGTGCCCTCGAGGCCGGTGCCACTCACATT
GATACCTCTGTTCTTGGTATCGGCGAGCGTAACGGTATCACCCCTCTCGGTGGCCTGATGGCCCGCATGATGGTC
GCCGACCGCGACTACGTCAAGGGCAAGTACAAGCTTGAGAAGCTCAAGGAGATTGAGGACCTCGTCGCCGAGGCC
GTTGAGGTCAACATTCCTTTCAACAACTACATCACCGGTTTCTGCGCCTTCACCCACAAGGCTGGTATCCACGCC
AAGGCCATCCTCAACAACCCCAGCACCTACGAGATTATCAACCCTGCCGATTTCGGCATGACCCGCTACGTCCAT
TTCGCCTCTCGTTTGACCGGATGGAACGCCATCAAGTCGCGTGCCCAGCAGCTCAAGCTTGAGATGACTGACGCT
CAATACAAGGAGTGCACTGCCAAGATTAAGGCTATGGCTGATATCCGTCCTATTGCCGTCGATGATGCCGACAGC
ATTATCCGTGCTTACCACCGTAACTTGAAGTCCGGCGAGAACAAGCCCCTTCTTGATCTGAGCGCCGAGGAGCAG
GCCGCATTCGCCGTCAAGGAGAAGGAGCTCCTTGCGGCTCAGGCTGCCGGTCTTGCGGTATAG
Gene >Pro_DTO377G3_2|g7739.t1
ATGTGTACTGGTGCCGACTCCGAGCCCAATGGGCAAGACAATGGTGCTCCTGGCGTCATTGCTCCTGGTATGCCA
ATTGAAAGCTAATATACCAGAATTGCCCACTGATCTTTATTTAGATGGCGATCACACTGGTTTTGTTGGCATTGA
GACTCGCCAAAACCCACACCCCTCCTCATCTCGCAACCCCTACGGTCACGACGCTGGCGTCACCGATTTCCTTAG
CAATGTCTCACGCTTCAAGATTATTGAGTCTACCTTGCGTGAGGGAGAGCAGTTCGCCAACGCCTTCTTCGATAC
CGCCAAGAAGATCGAGATTGCCAAGGCTCTCGATGACTTCGGTGTAGACTACGTGAGTCGCGGGACAGACGAAGT
CTTTATATCCCTGGATTGAGGTTAACGAAAATTACTCTATAGATTGAACTCACAAGTCCCTGCGCTTCTGAGCAG
TCCCGTGCGGATTGCGAGGCCATTTGCAAGCTTGGCCTGAAGGCTAAGGTATGTTAGGGTTCTGCTCTGATCTCG
TGATTATTGGTATCTAATGACATGTTCAGATTCTCACTCACATTCGCTGCCACATGGATGATGCCCGTATTGCTG
TCGAGACCGGTGTTGATGGAGTGTGAGTCGTGTCATCTTGTCCTATTTTCTTGACTCCGAACTGACTTTCCGTAG
TGATGTTGTTATTGGTACTTCCTCTTACCTCCGTGAGCACTCTCACGGCAAGGACATGACCTACATCAAGAACGC
CGCCATTGAAGTTATCGAGTTCGTCAAGTCCAAGGGCATTGAGATCCGCTTCTCCAGTGAGGACTCTTTCCGTTC
CGACCTGGTTGACCTTCTGTCAATCTACTCCGCCGTGGACAAGGTTGGTGTGAACCGTGTTGGTATTGCCGACAC
CGTTGGCTGCGCTTCCCCCCGCCAGGTTTACGAGCTCGTCCGTGTTCTGCGCGGTGTTGTTGGCTGTGACATCGA
GACTCACTTCCACAATGACACTGGTTGTGCCATTGCCAATGCCTTCTGTGCCCTCGAGGCCGGTGCCACTCACAT
TGATACCTCTGTTCTTGGTATCGGCGAGCGTAACGGTATCACCCCTCTCGGTGGCCTGATGGCCCGCATGATGGT
CGCCGACCGCGACTACGTCAAGGGCAAGTACAAGCTTGAGAAGCTCAAGGAGATTGAGGACCTCGTCGCCGAGGC
CGTTGAGGTCAACATTCCTTTCAACAACTACATCACCGGTTTCTGCGCCTTCACCCACAAGGCTGGTATCCACGC
CAAGGCCATCCTCAACAACCCCAGCACCTACGAGATTATCAACCCTGCCGATTTCGGCATGACCCGCTACGTCCA
TTTCGCCTCTCGTTTGACCGGATGGAACGCCATCAAGTCGCGTGCCCAGCAGCTCAAGCTTGAGATGACTGACGC
TCAATACAAGGAGTGCACTGCCAAGATTAAGGCTATGGCTGATATCCGTCCTATTGCCGTCGATGATGCCGACAG
CATTATCCGTGCTTACCACCGTAACTTGAAGTCCGGCGAGAACAAGCCCCTTCTTGATCTGAGCGCCGAGGAGCA
GGCCGCATTCGCCGTCAAGGAGAAGGAGCTCCTTGCGGCTCAGGCTGCCGGTCTTGCGGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail