Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7736.t1
Gene name
Locationscaffold_25:270280..270985
Strand-
Gene length (bp)705
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01981 PTH2 Peptidyl-tRNA hydrolase PTH2 3.9E-41 94 209

GO

GO Term Description Terminal node
GO:0004045 aminoacyl-tRNA hydrolase activity Yes
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0140098 catalytic activity, acting on RNA No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0052689 carboxylic ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7736.t1
MAAPVPLDRIPPTTAAYVIATAIIAGVTGYFIGQGSSISLFKEKEGWPNSYDVKVHSHSSDEEDESDSEEGETDE
EDEGNGEELSSFKDNSEEVKLVLVVRMDLGMTKGKIAAQCGHATLACYKYFLEYAPESPILRKWERGGQAKIALQ
VKSEDELLVMQAQAISLGLCARVIQDAGRTQIASGSKTVLGILGPRSVVDGVTGHLKLL*
Coding >Pro_DTO377G3_2|g7736.t1
ATGGCCGCACCAGTACCGCTAGATCGCATACCCCCCACGACGGCCGCCTATGTGATTGCAACAGCCATCATTGCA
GGCGTGACCGGATATTTCATCGGCCAAGGCTCCTCAATCAGCCTCTTCAAAGAAAAGGAAGGGTGGCCAAACAGC
TACGATGTGAAGGTCCACAGCCATTCCTCCGACGAGGAGGACGAATCAGACTCTGAAGAAGGAGAGACCGACGAG
GAAGATGAGGGCAACGGCGAAGAACTGTCGAGCTTCAAGGACAACAGCGAGGAGGTGAAGCTGGTGCTCGTCGTT
CGCATGGACCTAGGCATGACCAAAGGCAAAATCGCCGCTCAATGCGGCCACGCTACCCTTGCTTGCTACAAATAC
TTCCTCGAATACGCACCTGAGTCGCCTATCCTCAGAAAATGGGAGCGCGGTGGCCAGGCCAAGATCGCATTGCAG
GTTAAGTCCGAGGATGAGCTGCTAGTGATGCAGGCTCAGGCTATTAGCCTTGGACTTTGCGCGCGCGTTATTCAG
GATGCTGGGCGCACTCAAATTGCAAGTGGCAGCAAGACCGTGCTGGGAATCTTGGGACCCAGGAGCGTGGTGGAC
GGGGTGACGGGACACTTGAAGCTGTTGTAA
Transcript >Pro_DTO377G3_2|g7736.t1
ATGGCCGCACCAGTACCGCTAGATCGCATACCCCCCACGACGGCCGCCTATGTGATTGCAACAGCCATCATTGCA
GGCGTGACCGGATATTTCATCGGCCAAGGCTCCTCAATCAGCCTCTTCAAAGAAAAGGAAGGGTGGCCAAACAGC
TACGATGTGAAGGTCCACAGCCATTCCTCCGACGAGGAGGACGAATCAGACTCTGAAGAAGGAGAGACCGACGAG
GAAGATGAGGGCAACGGCGAAGAACTGTCGAGCTTCAAGGACAACAGCGAGGAGGTGAAGCTGGTGCTCGTCGTT
CGCATGGACCTAGGCATGACCAAAGGCAAAATCGCCGCTCAATGCGGCCACGCTACCCTTGCTTGCTACAAATAC
TTCCTCGAATACGCACCTGAGTCGCCTATCCTCAGAAAATGGGAGCGCGGTGGCCAGGCCAAGATCGCATTGCAG
GTTAAGTCCGAGGATGAGCTGCTAGTGATGCAGGCTCAGGCTATTAGCCTTGGACTTTGCGCGCGCGTTATTCAG
GATGCTGGGCGCACTCAAATTGCAAGTGGCAGCAAGACCGTGCTGGGAATCTTGGGACCCAGGAGCGTGGTGGAC
GGGGTGACGGGACACTTGAAGCTGTTGTAA
Gene >Pro_DTO377G3_2|g7736.t1
ATGGCCGCACCAGTACCGCTAGATCGCATACCCCCCACGACGGCCGCCTATGTGATTGCAACAGCCATCATTGCA
GGCGTGACCGGATATTTCATCGGCCAAGGCTCCTCAATCAGCCTCTTCAAAGAAAAGGAAGGGTGGCCAAACAGC
TACGATGTGAAGGTCCACAGCCATTCCTCCGACGAGGAGGACGAATCAGACTCTGAAGAAGGAGAGACCGACGAG
GAAGATGAGGGCAACGGCGAAGAACTGTCGAGCTTCAAGGACAACAGCGAGGAGGTGAAGCTGGTGCTCGTCGTT
CGCATGGACCTAGGCATGACCAAAGGTATGTGTTCTTCGCGCAACGTTTCAATTATTCCTCACATTTGTGTTGCA
AGCGCTTACAATCTCTTCCTTCTAGGCAAAATCGCCGCTCAATGCGGCCACGCTACCCTTGCTTGCTACAAATAC
TTCCTCGAATACGCACCTGAGTCGCCTATCCTCAGAAAATGGGAGCGCGGTGGCCAGGCCAAGATCGCATTGCAG
GTTAAGTCCGAGGATGAGCTGCTAGTGATGCAGGCTCAGGCTATTAGCCTTGGACTTTGCGCGCGCGTTATTCAG
GATGCTGGGCGCACTCAAATTGCAAGTGGCAGCAAGACCGTGCTGGGAATCTTGGGACCCAGGAGCGTGGTGGAC
GGGGTGACGGGACACTTGAAGCTGTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail