Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7732.t1
Gene name
Locationscaffold_25:259950..262359
Strand+
Gene length (bp)2409
Transcript length (bp)2208
Coding sequence length (bp)2208
Protein length (aa) 736

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02582 DUF155 RMND1/Sif2-Sif3/Mrx10, DUF155 2.4E-50 436 620

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 647 669 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 53.13 32.59 73.68
5d_25C Five days - 25 degrees Celsius 58.75 35.76 81.75
7d_25C Seven days - 25 degrees Celsius 55.32 33.70 76.95
10d_25C Ten days - 25 degrees Celsius 60.14 36.58 83.70
7d_15C Seven days - 15 degrees Celsius 90.67 54.19 127.16
7d_30C Seven days - 30 degrees Celsius 41.14 24.59 57.69

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.723264 no
3d_25C 7d_25C 0.899537 no
3d_25C 7d_15C 0.007437 yes
3d_25C 7d_30C 0.272556 no
3d_25C 10d_25C 0.649868 no
5d_25C 7d_25C 0.849953 no
5d_25C 7d_15C 0.038966 yes
5d_25C 7d_30C 0.102996 no
5d_25C 10d_25C 0.945906 no
7d_25C 7d_15C 0.016098 yes
7d_25C 7d_30C 0.200959 no
7d_25C 10d_25C 0.779953 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.052547 no
7d_30C 10d_25C 0.079688 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7732.t1
MTPPARGRGTSQRSPTVLVTDSRDQQQPQIPRRRRSPATRFITVDNVLQYASDVPSMQQRGPPPISRARRLASAS
GGLITSSGSSAVAGSGGTMGRLAAQPRLPPRTTKVSEKLVLLPDTGELEEGEIEEDDDSDGADLVDEELVARLAK
EKNIDPERIRRQLLVSKRLGGDFGIDNDFAPLLDEEEVMKKRRIAPERAKSYAERLPKARRTEKLARVTAYCTAQ
AYKMGSLATFVKEQHGGRTKLYDDCLYTAYHLPLLPGHEGYRLRSSPVLKYPGGKSLLDEEIERNELRDHHDEYM
LETEEHSVGGHNRPEDEHHYEAPPQPEGHDSQEGNHAEFLNGDSEEIRGHLLDDHEQATSSGSSVDGLQHISPLP
QPDSNQGTGQSSPEPALRRRRHSTDDTHTFIRDRPSLPAPTSSSSSTPQAPARTLYNVAEMFVFSYGVVVFWNFT
ERQEKDLLADLAFATSSATGIPIPLATMPLDEEDFETEEFHFEYSTEISRPRVYNDMITLRSGDHMIKLAISHGI
AQSTKLCFFEEVMARQMADAKDVPTRLAVSGQLGMKREEVFRILGRLFKSRVEVNLSSNMLDVPNFFWESEPTLY
PLYLAVREYLEIKPRIQVLNERCRVFLDLAEILSDSIADNRTSHQTWIIIVLIVISIIVTTSEVFLRFALLNSSQ
GSARSPANILARVMGRSVAPSPSPEWYPYSAANAPPGCICPSLGPPGAGSDMGVSGMIGY*
Coding >Pro_DTO377G3_2|g7732.t1
ATGACTCCGCCGGCCCGAGGACGAGGGACTAGCCAGCGCAGCCCAACCGTCTTGGTCACAGATTCAAGAGACCAG
CAACAGCCCCAGATACCGCGACGACGCCGCTCGCCCGCAACCCGGTTCATCACCGTCGACAACGTCCTCCAATAC
GCCTCTGACGTCCCTTCAATGCAGCAGCGCGGCCCACCACCAATCTCACGGGCACGCCGTCTTGCCTCCGCATCT
GGAGGCTTGATAACCAGCTCAGGCAGCAGCGCAGTAGCAGGATCCGGCGGCACGATGGGCCGACTCGCTGCGCAA
CCGCGACTCCCGCCTCGAACAACGAAAGTCAGTGAAAAGCTGGTTCTTCTGCCTGACACCGGCGAACTGGAGGAG
GGCGAAATTGAAGAAGACGATGACTCCGATGGTGCCGACCTCGTGGACGAGGAGCTTGTCGCGCGTCTAGCCAAG
GAGAAAAATATCGACCCGGAAAGGATCAGACGCCAATTGCTTGTGTCGAAGCGACTTGGGGGTGATTTCGGCATT
GATAATGATTTTGCACCCCTGCTGGATGAGGAAGAAGTCATGAAGAAACGCCGTATTGCTCCTGAGCGCGCGAAG
AGTTATGCGGAGCGGTTGCCAAAGGCGCGCCGGACGGAAAAGCTTGCGCGTGTTACGGCGTACTGTACAGCCCAG
GCGTATAAGATGGGGTCGCTTGCTACTTTTGTTAAGGAGCAGCATGGTGGACGGACAAAGCTCTATGATGATTGT
CTCTACACCGCGTATCACCTCCCTCTTTTGCCGGGCCATGAGGGGTATCGTCTGCGGAGTAGCCCTGTGCTGAAA
TACCCCGGTGGAAAATCCTTGTTGGATGAGGAGATTGAACGGAATGAACTTCGTGATCATCATGATGAATATATG
CTTGAGACGGAGGAGCATTCGGTTGGTGGACACAATCGTCCAGAGGATGAGCACCATTATGAAGCGCCGCCACAG
CCTGAGGGTCATGATTCCCAGGAGGGAAATCATGCGGAATTCTTGAATGGTGACAGTGAAGAAATTCGTGGCCAC
CTCCTTGATGACCATGAACAAGCTACCAGCTCCGGCTCTAGTGTCGATGGGTTGCAGCATATCTCGCCACTCCCG
CAACCAGACAGCAACCAAGGGACTGGGCAATCTTCGCCTGAACCTGCACTTCGCCGCCGAAGACACAGCACGGAT
GATACCCACACTTTTATTCGAGACCGTCCTTCTCTGCCAGCCCCTACATCCTCCTCGTCCTCAACACCGCAAGCC
CCAGCTCGGACGTTATACAATGTGGCTGAAATGTTCGTTTTCAGTTACGGCGTTGTCGTCTTCTGGAACTTCACC
GAGCGACAAGAGAAAGACCTGCTGGCCGATCTGGCATTTGCAACATCATCTGCAACTGGTATCCCTATCCCTCTA
GCGACGATGCCTCTTGATGAGGAGGACTTTGAGACAGAGGAGTTCCATTTCGAGTATTCGACTGAGATCTCGCGC
CCGCGAGTCTATAACGATATGATTACTCTTCGCAGTGGCGACCACATGATCAAGCTCGCTATTAGCCATGGTATT
GCACAGAGCACTAAACTCTGCTTCTTCGAGGAAGTCATGGCCCGACAGATGGCGGATGCTAAAGACGTTCCCACA
CGTCTTGCAGTTTCAGGCCAACTGGGCATGAAGCGCGAAGAAGTCTTCCGGATCTTGGGTCGATTGTTCAAGAGT
CGTGTCGAGGTCAACCTTTCTTCTAATATGCTCGACGTCCCCAACTTCTTCTGGGAGAGCGAGCCAACCCTTTAC
CCGCTCTACCTCGCCGTGCGCGAGTATTTGGAGATCAAACCACGCATCCAGGTCCTCAACGAGAGATGTCGCGTA
TTCCTCGATCTTGCAGAAATCTTGTCCGACTCGATTGCCGACAACCGCACTTCCCACCAAACCTGGATTATCATT
GTCCTCATCGTCATTTCAATCATTGTTACAACCTCCGAGGTCTTCCTCCGCTTCGCTCTTCTCAATTCAAGCCAA
GGGTCTGCCCGTTCACCTGCTAATATCTTAGCCCGTGTCATGGGCCGATCTGTCGCCCCTTCTCCATCCCCGGAG
TGGTACCCATACTCTGCCGCCAATGCACCTCCAGGCTGCATCTGTCCCTCTCTCGGACCTCCAGGCGCTGGATCG
GATATGGGCGTCAGCGGAATGATAGGATATTGA
Transcript >Pro_DTO377G3_2|g7732.t1
ATGACTCCGCCGGCCCGAGGACGAGGGACTAGCCAGCGCAGCCCAACCGTCTTGGTCACAGATTCAAGAGACCAG
CAACAGCCCCAGATACCGCGACGACGCCGCTCGCCCGCAACCCGGTTCATCACCGTCGACAACGTCCTCCAATAC
GCCTCTGACGTCCCTTCAATGCAGCAGCGCGGCCCACCACCAATCTCACGGGCACGCCGTCTTGCCTCCGCATCT
GGAGGCTTGATAACCAGCTCAGGCAGCAGCGCAGTAGCAGGATCCGGCGGCACGATGGGCCGACTCGCTGCGCAA
CCGCGACTCCCGCCTCGAACAACGAAAGTCAGTGAAAAGCTGGTTCTTCTGCCTGACACCGGCGAACTGGAGGAG
GGCGAAATTGAAGAAGACGATGACTCCGATGGTGCCGACCTCGTGGACGAGGAGCTTGTCGCGCGTCTAGCCAAG
GAGAAAAATATCGACCCGGAAAGGATCAGACGCCAATTGCTTGTGTCGAAGCGACTTGGGGGTGATTTCGGCATT
GATAATGATTTTGCACCCCTGCTGGATGAGGAAGAAGTCATGAAGAAACGCCGTATTGCTCCTGAGCGCGCGAAG
AGTTATGCGGAGCGGTTGCCAAAGGCGCGCCGGACGGAAAAGCTTGCGCGTGTTACGGCGTACTGTACAGCCCAG
GCGTATAAGATGGGGTCGCTTGCTACTTTTGTTAAGGAGCAGCATGGTGGACGGACAAAGCTCTATGATGATTGT
CTCTACACCGCGTATCACCTCCCTCTTTTGCCGGGCCATGAGGGGTATCGTCTGCGGAGTAGCCCTGTGCTGAAA
TACCCCGGTGGAAAATCCTTGTTGGATGAGGAGATTGAACGGAATGAACTTCGTGATCATCATGATGAATATATG
CTTGAGACGGAGGAGCATTCGGTTGGTGGACACAATCGTCCAGAGGATGAGCACCATTATGAAGCGCCGCCACAG
CCTGAGGGTCATGATTCCCAGGAGGGAAATCATGCGGAATTCTTGAATGGTGACAGTGAAGAAATTCGTGGCCAC
CTCCTTGATGACCATGAACAAGCTACCAGCTCCGGCTCTAGTGTCGATGGGTTGCAGCATATCTCGCCACTCCCG
CAACCAGACAGCAACCAAGGGACTGGGCAATCTTCGCCTGAACCTGCACTTCGCCGCCGAAGACACAGCACGGAT
GATACCCACACTTTTATTCGAGACCGTCCTTCTCTGCCAGCCCCTACATCCTCCTCGTCCTCAACACCGCAAGCC
CCAGCTCGGACGTTATACAATGTGGCTGAAATGTTCGTTTTCAGTTACGGCGTTGTCGTCTTCTGGAACTTCACC
GAGCGACAAGAGAAAGACCTGCTGGCCGATCTGGCATTTGCAACATCATCTGCAACTGGTATCCCTATCCCTCTA
GCGACGATGCCTCTTGATGAGGAGGACTTTGAGACAGAGGAGTTCCATTTCGAGTATTCGACTGAGATCTCGCGC
CCGCGAGTCTATAACGATATGATTACTCTTCGCAGTGGCGACCACATGATCAAGCTCGCTATTAGCCATGGTATT
GCACAGAGCACTAAACTCTGCTTCTTCGAGGAAGTCATGGCCCGACAGATGGCGGATGCTAAAGACGTTCCCACA
CGTCTTGCAGTTTCAGGCCAACTGGGCATGAAGCGCGAAGAAGTCTTCCGGATCTTGGGTCGATTGTTCAAGAGT
CGTGTCGAGGTCAACCTTTCTTCTAATATGCTCGACGTCCCCAACTTCTTCTGGGAGAGCGAGCCAACCCTTTAC
CCGCTCTACCTCGCCGTGCGCGAGTATTTGGAGATCAAACCACGCATCCAGGTCCTCAACGAGAGATGTCGCGTA
TTCCTCGATCTTGCAGAAATCTTGTCCGACTCGATTGCCGACAACCGCACTTCCCACCAAACCTGGATTATCATT
GTCCTCATCGTCATTTCAATCATTGTTACAACCTCCGAGGTCTTCCTCCGCTTCGCTCTTCTCAATTCAAGCCAA
GGGTCTGCCCGTTCACCTGCTAATATCTTAGCCCGTGTCATGGGCCGATCTGTCGCCCCTTCTCCATCCCCGGAG
TGGTACCCATACTCTGCCGCCAATGCACCTCCAGGCTGCATCTGTCCCTCTCTCGGACCTCCAGGCGCTGGATCG
GATATGGGCGTCAGCGGAATGATAGGATATTGA
Gene >Pro_DTO377G3_2|g7732.t1
ATGACTCCGCCGGCCCGAGGACGAGGGACTAGCCAGCGCAGCCCAACCGTCTTGGTAGGATTGACTATCAAATCA
ACCGTACAACCAAGCTCAACTAACACATATTTTTAATACAGGTCACAGATTCAAGAGACCAGCAACAGCCCCAGA
TACCGCGACGACGCCGCTCGCCCGCAACCCGGTTCATCACCGTCGACAACGTCCTCCAATACGCCTCTGACGTCC
CTTCAATGCAGCAGCGCGGCCCACCACCAATCTCACGGGCACGCCGTCTTGCCTCCGCATCTGGAGGCTTGATAA
CCAGCTCAGGCAGCAGCGCAGTAGCAGGATCCGGCGGCACGATGGGCCGACTCGCTGCGCAACCGCGACTCCCGC
CTCGAACAACGAAAGTCAGTGAAAAGCTGGTTCTTCTGCCTGACACCGGCGAACTGGAGGAGGGCGAAATTGAAG
AAGACGATGACTCCGATGGTGCCGACCTCGTGGACGAGGAGCTTGTCGCGCGTCTAGCCAAGGAGAAAAATATCG
ACCCGGAAAGGATCAGACGCCAATTGCTTGTGTCGAAGCGACTTGGGGGTGATTTCGGCATTGATAATGATTTTG
CACCCCTGCTGGATGAGGAAGAAGTCATGAAGAAACGCCGTATTGCTCCTGAGCGCGCGAAGAGTTATGCGGAGC
GGTTGCCAAAGGCGCGCCGGACGGAAAAGCTTGCGCGTGTTACGGCGTACTGTACAGCCCAGGCGTATAAGATGG
GGTCGCTTGCTACTTTTGTTAAGGAGCAGCATGGTGGACGGACAAAGCTCTATGATGATTGTCTCTACACCGCGT
ATCACCTCCCTCTTTTGCCGGGCCATGAGGGGTATCGTCTGCGGAGTAGCCCTGTGCTGAAATACCCCGGTGGAA
AATCCTTGTTGGATGAGGAGATTGAACGGAATGAACTTCGTGATCATCATGATGAATATATGCTTGAGACGGAGG
AGCATTCGGTTGGTGGACACAATCGTCCAGAGGATGAGCACCATTATGAAGCGCCGCCACAGCCTGAGGGTCATG
ATTCCCAGGAGGGAAATCATGCGGAATTCTTGAATGGTGACAGTGAAGAAATTCGTGGCCACCTCCTTGATGACC
ATGAACAAGCTACCAGCTCCGGCTCTAGTGTCGATGGGTTGCAGCATATCTCGCCACTCCCGCAACCAGACAGCA
ACCAAGGGACTGGGCAATCTTCGCCTGAACCTGCACTTCGCCGCCGAAGACACAGCACGGATGATACCCACACTT
TTATTCGAGACCGTCCTTCTCTGCCAGCCCCTACATCCTCCTCGTCCTCAACACCGCAAGCCCCAGCTCGGACGT
TATACAATGTGGCTGAAATGTTCGTTTTCAGTTACGGCGTTGTCGTCTTCTGGAACTTCACCGAGCGACAAGAGA
AAGACCTGCTGGCCGATCTGGCATTTGCAACATCATCTGCAACTGGTATCCCTATCCCTCTAGCGACGATGCCTC
TTGATGAGGAGGACTTTGAGACAGAGGAGTTCCATTTCGAGTATTCGACTGAGATCTCGCGCCCGCGAGTCTATA
ACGATATGATTACTCTTCGCAGTGGCGACCACATGATCAAGCTCGCTATTAGCCATGGTATTGCACAGAGCACTA
AACTCTGCTTCTTCGAGGAAGTCATGGCCCGACAGATGGCGGATGCTAAAGACGTTCCCACACGTCTTGCAGTTT
CAGGCCAACTGGGCATGAAGCGCGAAGAAGTCTTCCGGATCTTGGGTCGATTGTTCAAGAGTCGTGTCGAGGTCA
ACCTTTGTAAGTTCCTAACCCCCTTTATGGGTCGTCTTGCAAGCTATGCTGCAGATAAGAGACTTTGTTCCCTAC
TAACATTCTCCACTAGCTTCTAATATGCTCGACGTCCCCAACTTCTTCTGGGAGAGCGAGCCAACCCTTTACCCG
CTCTACCTCGCCGTGCGCGAGTATTTGGAGATCAAACCACGCATCCAGGTCCTCAACGAGAGATGTCGCGTATTC
CTCGATCTTGCAGAAATCTTGTCCGACTCGATTGCCGACAACCGCACTTCCCGTATGTCTAACCTTCTCTTTTCG
CTCCCCAGCCTCCCAACTAACCTCACTCTAGACCAAACCTGGATTATCATTGTCCTCATCGTCATTTCAATCATT
GTTACAACCTCCGAGGTCTTCCTCCGCTTCGCTCTTCTCAATTCAAGCCAAGGGTCTGCCCGTTCACCTGCTAAT
ATCTTAGCCCGTGTCATGGGCCGATCTGTCGCCCCTTCTCCATCCCCGGAGTGGTACCCATACTCTGCCGCCAAT
GCACCTCCAGGCTGCATCTGTCCCTCTCTCGGACCTCCAGGCGCTGGATCGGATATGGGCGTCAGCGGAATGATA
GGATATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail