Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7728.t1
Gene name
Locationscaffold_25:253917..254415
Strand+
Gene length (bp)498
Transcript length (bp)375
Coding sequence length (bp)375
Protein length (aa) 125

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 10.64 1.29 19.98
5d_25C Five days - 25 degrees Celsius 8.68 0.18 17.19
7d_25C Seven days - 25 degrees Celsius 2.92 0.00 6.58
10d_25C Ten days - 25 degrees Celsius 4.36 0.00 9.41
7d_15C Seven days - 15 degrees Celsius 3.93 0.00 8.93
7d_30C Seven days - 30 degrees Celsius 15.75 2.09 29.42

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.778527 no
3d_25C 7d_25C 0.046552 yes
3d_25C 7d_15C 0.131752 no
3d_25C 7d_30C 0.499008 no
3d_25C 10d_25C 0.149058 no
5d_25C 7d_25C 0.097861 no
5d_25C 7d_15C 0.259033 no
5d_25C 7d_30C 0.295431 no
5d_25C 10d_25C 0.304288 no
7d_25C 7d_15C 0.758449 no
7d_25C 7d_30C 0.008807 yes
7d_25C 10d_25C 0.643269 no
7d_15C 7d_30C 0.038184 yes
7d_15C 10d_25C 0.923186 no
7d_30C 10d_25C 0.035243 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7728.t1
MHLWKAFILTLAHLALSQAAACPAGGCGSAPACVLTETCTTATFVSPSTTTITTCVPTPTCAGVYSSCEFGTPNN
QCCSGYCAANKCRSTDDGWPSCSEDNGPCVVDEHCCYGNTCTNGICSRT*
Coding >Pro_DTO377G3_2|g7728.t1
ATGCATCTCTGGAAGGCTTTTATTCTTACCCTTGCTCACCTCGCCCTGAGCCAAGCAGCAGCTTGTCCAGCAGGA
GGATGTGGTAGTGCCCCGGCTTGCGTTCTCACCGAGACATGCACAACAGCAACCTTTGTCTCACCCTCCACAACG
ACTATCACAACCTGTGTCCCAACACCCACTTGCGCGGGAGTCTACTCATCCTGTGAGTTCGGCACCCCGAACAAC
CAATGCTGCTCGGGCTACTGCGCTGCCAACAAATGCCGATCGACAGATGATGGGTGGCCGTCTTGTAGCGAGGAC
AATGGGCCTTGCGTTGTCGACGAACACTGCTGTTATGGGAATACCTGCACCAATGGGATTTGTAGCCGGACTTGA
Transcript >Pro_DTO377G3_2|g7728.t1
ATGCATCTCTGGAAGGCTTTTATTCTTACCCTTGCTCACCTCGCCCTGAGCCAAGCAGCAGCTTGTCCAGCAGGA
GGATGTGGTAGTGCCCCGGCTTGCGTTCTCACCGAGACATGCACAACAGCAACCTTTGTCTCACCCTCCACAACG
ACTATCACAACCTGTGTCCCAACACCCACTTGCGCGGGAGTCTACTCATCCTGTGAGTTCGGCACCCCGAACAAC
CAATGCTGCTCGGGCTACTGCGCTGCCAACAAATGCCGATCGACAGATGATGGGTGGCCGTCTTGTAGCGAGGAC
AATGGGCCTTGCGTTGTCGACGAACACTGCTGTTATGGGAATACCTGCACCAATGGGATTTGTAGCCGGACTTGA
Gene >Pro_DTO377G3_2|g7728.t1
ATGCATCTCTGGAAGGCTTTTATTCTTACCCTTGCTCACCTCGCCCTGAGCCGTATGTATCCCAACAAACACCTA
CATTGGCCCCCACCCTACTAACCACACCTTCCCTCAAAATAGAAGCAGCAGCTTGTCCAGCAGGAGGATGTGGTA
GTGCCCCGGCTTGCGTTCTCACCGAGACATGCACAACAGCAACCTTTGTCTCACCCTCCACAACGACTATCACAA
CCTGTGTCCCAACACCCACTTGCGCGGGAGTCTACTGTAAGAATGAGAGACCACATCCAATCACAACGTTGAACG
TACCTCTAATTAATACTAGCATCCTGTGAGTTCGGCACCCCGAACAACCAATGCTGCTCGGGCTACTGCGCTGCC
AACAAATGCCGATCGACAGATGATGGGTGGCCGTCTTGTAGCGAGGACAATGGGCCTTGCGTTGTCGACGAACAC
TGCTGTTATGGGAATACCTGCACCAATGGGATTTGTAGCCGGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail