Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7727.t1
Gene name
Locationscaffold_25:250045..250982
Strand-
Gene length (bp)937
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 5.9E-07 143 199
PF13242 Hydrolase_like HAD-hyrolase-like 3.4E-05 145 199

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.67 0.00 1.51
5d_25C Five days - 25 degrees Celsius 1.07 0.00 2.40
7d_25C Seven days - 25 degrees Celsius 0.94 0.00 2.17
10d_25C Ten days - 25 degrees Celsius 0.30 0.00 0.81
7d_15C Seven days - 15 degrees Celsius 0.63 0.00 1.52
7d_30C Seven days - 30 degrees Celsius 3.40 0.52 6.27

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.627419 no
3d_25C 7d_25C 0.733844 no
3d_25C 7d_15C 1.000000 no
3d_25C 7d_30C 0.023923 yes
3d_25C 10d_25C 1.000000 no
5d_25C 7d_25C 0.912368 no
5d_25C 7d_15C 0.604939 no
5d_25C 7d_30C 0.093253 no
5d_25C 10d_25C 0.237706 no
7d_25C 7d_15C 0.715872 no
7d_25C 7d_30C 0.062457 no
7d_25C 10d_25C 0.282615 no
7d_15C 7d_30C 0.046159 yes
7d_15C 10d_25C 1.000000 no
7d_30C 10d_25C 0.051825 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7727.t1
MAPPNPDFPAVRACIFDMDGLLINSEDIISLSTNQLLERLDKWRYIPPLGQVTYLPREIARESSEGMRLFFPDCR
PLPGAEKILSNLSRARSASSGDVIQLALASSTKTRSYELKTAGPESKLLLSFFRSDRRILGDDPRMRRGRGKPAP
DIYLLALQSLNSGIDSEEKAILPNECLVFEDSIAGVEAGRRAGMRVVWVPHPDVAVEYQPMHKDILAGRSGRFKV
GDDWQLGEIDDGWAESIPSLEDFDYEKYGLDVAF*
Coding >Pro_DTO377G3_2|g7727.t1
ATGGCTCCCCCTAATCCAGACTTCCCCGCAGTCCGCGCCTGCATTTTCGACATGGACGGGCTCCTCATCAACTCT
GAAGACATAATCAGTCTATCCACGAACCAACTGCTGGAAAGACTCGACAAATGGCGATATATTCCACCACTGGGC
CAAGTTACCTATCTCCCGCGAGAAATTGCCCGTGAATCAAGCGAGGGCATGCGACTATTTTTCCCGGATTGCAGG
CCGTTGCCTGGCGCGGAGAAGATTCTATCGAATCTAAGCCGTGCACGGAGTGCTTCGTCTGGGGACGTGATTCAG
CTGGCTTTGGCTTCCAGCACCAAGACCCGTAGTTATGAGTTGAAAACTGCGGGGCCGGAATCGAAACTACTGTTG
AGCTTCTTTCGGTCGGACAGGAGAATCCTGGGTGATGATCCACGAATGCGACGGGGTCGAGGGAAGCCAGCGCCC
GATATTTATTTGCTCGCGTTGCAGTCTTTGAACTCGGGAATAGACTCTGAGGAAAAGGCTATCCTGCCCAATGAA
TGTTTAGTCTTCGAGGATAGCATCGCTGGTGTAGAGGCTGGGAGACGCGCTGGTATGAGAGTTGTTTGGGTACCG
CATCCAGATGTGGCGGTCGAGTATCAGCCGATGCATAAAGATATCCTGGCTGGGAGATCAGGAAGATTTAAGGTC
GGAGATGACTGGCAGCTAGGAGAGATTGATGATGGCTGGGCAGAAAGTATACCTAGTCTGGAAGACTTTGATTAC
GAGAAGTACGGCCTCGATGTGGCATTTTAA
Transcript >Pro_DTO377G3_2|g7727.t1
ATGGCTCCCCCTAATCCAGACTTCCCCGCAGTCCGCGCCTGCATTTTCGACATGGACGGGCTCCTCATCAACTCT
GAAGACATAATCAGTCTATCCACGAACCAACTGCTGGAAAGACTCGACAAATGGCGATATATTCCACCACTGGGC
CAAGTTACCTATCTCCCGCGAGAAATTGCCCGTGAATCAAGCGAGGGCATGCGACTATTTTTCCCGGATTGCAGG
CCGTTGCCTGGCGCGGAGAAGATTCTATCGAATCTAAGCCGTGCACGGAGTGCTTCGTCTGGGGACGTGATTCAG
CTGGCTTTGGCTTCCAGCACCAAGACCCGTAGTTATGAGTTGAAAACTGCGGGGCCGGAATCGAAACTACTGTTG
AGCTTCTTTCGGTCGGACAGGAGAATCCTGGGTGATGATCCACGAATGCGACGGGGTCGAGGGAAGCCAGCGCCC
GATATTTATTTGCTCGCGTTGCAGTCTTTGAACTCGGGAATAGACTCTGAGGAAAAGGCTATCCTGCCCAATGAA
TGTTTAGTCTTCGAGGATAGCATCGCTGGTGTAGAGGCTGGGAGACGCGCTGGTATGAGAGTTGTTTGGGTACCG
CATCCAGATGTGGCGGTCGAGTATCAGCCGATGCATAAAGATATCCTGGCTGGGAGATCAGGAAGATTTAAGGTC
GGAGATGACTGGCAGCTAGGAGAGATTGATGATGGCTGGGCAGAAAGTATACCTAGTCTGGAAGACTTTGATTAC
GAGAAGTACGGCCTCGATGTGGCATTTTAA
Gene >Pro_DTO377G3_2|g7727.t1
ATGGCTCCCCCTAATCCAGAGTGAGTGACCTCGAACATGTGCATCTATATACGACAATTAGCGGAGGCATTAAAG
TCAACATACGAATTCTGTAATCCGCGAAGCTAACACAGACCACCAGCTTCCCCGCAGTCCGCGCCTGCATTTTCG
ACATGGACGGGCTCCTCATCAACTCTGAAGACATAATCAGTCTATCCACGAACCAACTGCTGGAAAGGTACGGAA
GGCCTCCGTTGACTCCGTCGATTCGAGCCCAGCTCATGGGTGTCGCAGACTCGACAAATGGCGATATATTCCACC
ACTGGGCCAAGTTACCTATCTCCCGCGAGAAATTGCCCGTGAATCAAGCGAGGGCATGCGACTATTTTTCCCGGA
TTGCAGGCCGTTGCCTGGCGCGGAGAAGATTCTATCGAATCTAAGCCGTGCACGGAGTGCTTCGTCTGGGGACGT
GATTCAGCTGGCTTTGGCTTCCAGCACCAAGACCCGTAGTTATGAGTTGAAAACTGCGGGGCCGGAATCGAAACT
ACTGTTGAGCTTCTTTCGGTCGGACAGGAGAATCCTGGGTGATGATCCACGAATGCGACGGGGTCGAGGGAAGCC
AGCGCCCGATATTTATTTGCTCGCGTTGCAGTCTTTGAACTCGGGAATAGACTCTGAGGAAAAGGCTATCCTGCC
CAATGAATGTTTAGTCTTCGAGGATAGCATCGCTGGTGTAGAGGCTGGGAGACGCGCTGGTATGAGAGTTGTTTG
GGTACCGCATCCAGATGTGGCGGTCGAGTATCAGCCGATGCATAAAGATATCCTGGCTGGGAGATCAGGAAGATT
TAAGGTCGGAGATGACTGGCAGCTAGGAGAGATTGATGATGGCTGGGCAGAAAGTATACCTAGTCTGGAAGACTT
TGATTACGAGAAGTACGGCCTCGATGTGGCATTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail