Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7723.t1
Gene name
Locationscaffold_25:235709..238870
Strand-
Gene length (bp)3161
Transcript length (bp)2631
Coding sequence length (bp)2631
Protein length (aa) 877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05057 DUF676 Putative serine esterase (DUF676) 9.4E-07 28 149

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 0.61 0.01 1.20
5d_25C Five days - 25 degrees Celsius 0.79 0.10 1.48
7d_25C Seven days - 25 degrees Celsius 0.95 0.13 1.78
10d_25C Ten days - 25 degrees Celsius 1.03 0.19 1.87
7d_15C Seven days - 15 degrees Celsius 1.07 0.13 2.00
7d_30C Seven days - 30 degrees Celsius 1.40 0.29 2.52

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.685323 no
3d_25C 7d_25C 0.455910 no
3d_25C 7d_15C 0.325729 no
3d_25C 7d_30C 0.099736 no
3d_25C 10d_25C 0.329542 no
5d_25C 7d_25C 0.787194 no
5d_25C 7d_15C 0.635976 no
5d_25C 7d_30C 0.253364 no
5d_25C 10d_25C 0.660037 no
7d_25C 7d_15C 0.876759 no
7d_25C 7d_30C 0.475083 no
7d_25C 10d_25C 0.912980 no
7d_15C 7d_30C 0.650009 no
7d_15C 10d_25C 0.961677 no
7d_30C 10d_25C 0.564057 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7723.t1
MATMSFAPTGHLQVLRDPPDESQDGIDIVLVPGIGTILPAEWPFAKEEWLATLPSSSAGTRVLAYEYASPFATAK
PSWESILMLGHDLLQHVSDGRYSDATANKPILIVCHSLGGIIVKQALCVANKQFNRYESIINAIAGVIFLSTPHR
YGDKTTSLIRFRDIFEATTSRNLNIPSTNIEQEGAILLDLADRFEKVSFSTPILSAYELRESKTSSTTLQHKYQQ
LVNREACSTRARMETVIGLNLNHHDTCLFTQSVGGESLPEFNNFVYNTLRAAARLFAIQLKDQESQDATTSAYSP
TMSELPLKFKLNIYILPGYHRCRLVEQLGLTESPSNKATDGTSLSGFELVTPIAPKSDIVKPLHIPCFLLNTHSA
NQDFCGREDILERLATELLPPKNRVTASGTAIRQFALCGFGGIGKTEIAREFARRHKHPFDAVFWVLADEVAKLD
HHYQQISLALGLEESSECKSQVVSREIVKGWLSNPRKHISGSDDFIQPGEASSEATWLLIFDNADEPIILADYWL
QGSGSILITSPLSQQDSLSLFNHLTTVSNDLEVDTAQKISDALGGMAISQMAGIIRRQDLTLSEFFELYMDHEEH
ASPYETKFDTNLVTYRHSLSTVWAFGKLKPQTQQLLELISFLDPDSIGEDLLEASVELISEGTSFKKSNYIEART
DLLQSSLVQRDKQKQQISVHRIVQDVILATMDVEKKRSMFDQVSLTFSRYQKERGRTKQFDGFFETARSIRESST
HPDRDSLLADIHFCLGAIAMDASNFGTSRIHKERSFDLVSKICNELGTADDRLYLAYAERGISRIQDGRYEEGEA
DLKEALRIRKALGNYIPRSGEANLSWALLLQGKLKSPTHFFWIAWPAEKRL*
Coding >Pro_DTO377G3_2|g7723.t1
ATGGCTACGATGAGCTTTGCACCTACTGGCCACCTTCAGGTACTGCGGGATCCACCTGATGAATCTCAGGATGGC
ATCGATATTGTTCTCGTTCCTGGCATCGGAACTATCTTACCGGCAGAATGGCCGTTTGCCAAAGAAGAATGGCTT
GCCACCCTACCAAGTTCCAGTGCTGGGACACGCGTCCTCGCCTACGAATATGCTTCGCCATTTGCGACCGCCAAG
CCTTCATGGGAGTCGATCTTGATGCTAGGTCACGACCTTCTCCAGCATGTAAGCGACGGGCGATACTCAGACGCG
ACTGCCAACAAGCCAATCTTGATAGTCTGCCACAGCTTAGGTGGTATTATAGTCAAACAGGCATTATGTGTCGCC
AACAAGCAGTTTAACCGGTACGAATCAATTATCAACGCTATAGCTGGCGTTATCTTCCTAAGCACTCCGCATCGC
TATGGCGACAAGACCACCAGTTTGATACGGTTTCGAGATATATTTGAAGCGACGACCAGCAGAAACTTGAATATT
CCAAGTACCAATATCGAGCAAGAAGGTGCCATTTTGCTTGACCTTGCAGATAGATTCGAAAAAGTCTCATTCAGT
ACCCCCATACTATCCGCGTACGAACTGAGAGAATCGAAAACCAGTTCGACTACACTGCAGCATAAATACCAACAA
TTGGTCAACCGTGAAGCTTGTTCAACTCGCGCCCGAATGGAAACAGTCATTGGCCTTAATCTTAATCATCACGAT
ACATGTCTTTTCACCCAGAGCGTTGGTGGCGAAAGTCTACCGGAGTTTAACAATTTTGTCTACAACACTTTGCGT
GCCGCCGCGCGTCTTTTTGCTATTCAACTCAAGGACCAGGAATCTCAAGATGCAACGACGAGCGCTTACTCCCCC
ACAATGAGCGAATTACCACTAAAATTTAAGCTGAATATCTACATATTACCAGGTTATCATAGATGTCGGTTAGTT
GAGCAATTGGGACTCACGGAGTCGCCATCCAACAAAGCAACGGACGGAACATCTCTTTCGGGGTTTGAGTTGGTA
ACTCCTATAGCACCAAAATCTGATATTGTGAAACCCCTCCACATACCATGCTTCCTTCTCAATACGCATTCAGCA
AATCAGGATTTCTGCGGCCGTGAAGATATCTTGGAACGTCTCGCAACCGAGCTCTTACCTCCAAAGAACAGAGTG
ACAGCATCGGGCACCGCTATAAGGCAGTTTGCACTTTGTGGATTTGGAGGAATTGGAAAGACGGAAATAGCTCGC
GAGTTTGCCCGGCGTCACAAACATCCCTTTGATGCGGTATTCTGGGTCTTGGCGGATGAAGTTGCAAAACTTGAT
CACCATTACCAGCAAATATCGTTAGCACTAGGACTCGAAGAATCATCCGAGTGCAAAAGCCAGGTTGTCAGTAGA
GAGATTGTGAAAGGGTGGCTCTCTAATCCTCGAAAGCATATATCAGGGTCGGATGATTTTATTCAACCTGGCGAA
GCTAGCTCGGAAGCAACTTGGTTGCTTATATTCGACAACGCAGATGAGCCAATAATTCTGGCAGACTACTGGCTC
CAAGGCAGTGGATCGATTCTTATCACTAGTCCACTTTCACAGCAAGACAGCCTATCCCTTTTCAACCACCTCACT
ACTGTCTCTAACGACCTAGAAGTTGACACAGCGCAAAAAATTTCCGATGCACTTGGTGGAATGGCCATTTCTCAG
ATGGCTGGTATTATCCGTCGACAAGACCTCACTCTTTCAGAGTTTTTTGAGCTGTATATGGACCATGAAGAACAT
GCCAGTCCTTATGAAACAAAGTTCGATACGAACTTGGTCACATATCGTCACTCTCTCTCCACCGTATGGGCATTT
GGGAAGCTCAAGCCTCAAACTCAACAGCTTTTGGAACTGATATCATTTCTTGATCCGGATTCCATCGGAGAAGAC
TTATTGGAAGCATCCGTGGAGCTGATTTCCGAGGGCACATCGTTTAAGAAAAGTAACTATATTGAGGCTCGAACT
GATCTCTTGCAATCATCTCTGGTCCAAAGAGATAAGCAAAAGCAGCAAATATCAGTTCATCGCATTGTGCAAGAT
GTGATACTAGCAACAATGGATGTTGAGAAGAAACGGTCCATGTTTGACCAAGTGAGTCTAACATTCTCCCGGTAT
CAAAAAGAGCGTGGACGGACAAAGCAATTTGATGGCTTCTTCGAAACTGCTCGCAGCATCCGCGAGTCCTCAACA
CACCCAGATCGGGATTCCCTGCTTGCAGATATCCATTTCTGCCTAGGAGCTATAGCCATGGATGCGAGCAATTTC
GGCACAAGCCGCATCCACAAGGAGCGTTCTTTTGATCTAGTTTCCAAAATTTGCAACGAACTTGGAACTGCAGAC
GACAGATTATACCTCGCCTACGCAGAACGAGGGATCTCACGGATCCAGGACGGACGGTACGAGGAAGGGGAGGCC
GACCTAAAGGAGGCGCTGCGGATACGCAAGGCTCTCGGTAACTACATTCCGCGGTCTGGCGAGGCCAACCTGAGC
TGGGCTCTCCTTTTGCAGGGCAAGTTGAAGAGTCCAACACACTTCTTCTGGATAGCCTGGCCGGCAGAGAAAAGG
CTTTAG
Transcript >Pro_DTO377G3_2|g7723.t1
ATGGCTACGATGAGCTTTGCACCTACTGGCCACCTTCAGGTACTGCGGGATCCACCTGATGAATCTCAGGATGGC
ATCGATATTGTTCTCGTTCCTGGCATCGGAACTATCTTACCGGCAGAATGGCCGTTTGCCAAAGAAGAATGGCTT
GCCACCCTACCAAGTTCCAGTGCTGGGACACGCGTCCTCGCCTACGAATATGCTTCGCCATTTGCGACCGCCAAG
CCTTCATGGGAGTCGATCTTGATGCTAGGTCACGACCTTCTCCAGCATGTAAGCGACGGGCGATACTCAGACGCG
ACTGCCAACAAGCCAATCTTGATAGTCTGCCACAGCTTAGGTGGTATTATAGTCAAACAGGCATTATGTGTCGCC
AACAAGCAGTTTAACCGGTACGAATCAATTATCAACGCTATAGCTGGCGTTATCTTCCTAAGCACTCCGCATCGC
TATGGCGACAAGACCACCAGTTTGATACGGTTTCGAGATATATTTGAAGCGACGACCAGCAGAAACTTGAATATT
CCAAGTACCAATATCGAGCAAGAAGGTGCCATTTTGCTTGACCTTGCAGATAGATTCGAAAAAGTCTCATTCAGT
ACCCCCATACTATCCGCGTACGAACTGAGAGAATCGAAAACCAGTTCGACTACACTGCAGCATAAATACCAACAA
TTGGTCAACCGTGAAGCTTGTTCAACTCGCGCCCGAATGGAAACAGTCATTGGCCTTAATCTTAATCATCACGAT
ACATGTCTTTTCACCCAGAGCGTTGGTGGCGAAAGTCTACCGGAGTTTAACAATTTTGTCTACAACACTTTGCGT
GCCGCCGCGCGTCTTTTTGCTATTCAACTCAAGGACCAGGAATCTCAAGATGCAACGACGAGCGCTTACTCCCCC
ACAATGAGCGAATTACCACTAAAATTTAAGCTGAATATCTACATATTACCAGGTTATCATAGATGTCGGTTAGTT
GAGCAATTGGGACTCACGGAGTCGCCATCCAACAAAGCAACGGACGGAACATCTCTTTCGGGGTTTGAGTTGGTA
ACTCCTATAGCACCAAAATCTGATATTGTGAAACCCCTCCACATACCATGCTTCCTTCTCAATACGCATTCAGCA
AATCAGGATTTCTGCGGCCGTGAAGATATCTTGGAACGTCTCGCAACCGAGCTCTTACCTCCAAAGAACAGAGTG
ACAGCATCGGGCACCGCTATAAGGCAGTTTGCACTTTGTGGATTTGGAGGAATTGGAAAGACGGAAATAGCTCGC
GAGTTTGCCCGGCGTCACAAACATCCCTTTGATGCGGTATTCTGGGTCTTGGCGGATGAAGTTGCAAAACTTGAT
CACCATTACCAGCAAATATCGTTAGCACTAGGACTCGAAGAATCATCCGAGTGCAAAAGCCAGGTTGTCAGTAGA
GAGATTGTGAAAGGGTGGCTCTCTAATCCTCGAAAGCATATATCAGGGTCGGATGATTTTATTCAACCTGGCGAA
GCTAGCTCGGAAGCAACTTGGTTGCTTATATTCGACAACGCAGATGAGCCAATAATTCTGGCAGACTACTGGCTC
CAAGGCAGTGGATCGATTCTTATCACTAGTCCACTTTCACAGCAAGACAGCCTATCCCTTTTCAACCACCTCACT
ACTGTCTCTAACGACCTAGAAGTTGACACAGCGCAAAAAATTTCCGATGCACTTGGTGGAATGGCCATTTCTCAG
ATGGCTGGTATTATCCGTCGACAAGACCTCACTCTTTCAGAGTTTTTTGAGCTGTATATGGACCATGAAGAACAT
GCCAGTCCTTATGAAACAAAGTTCGATACGAACTTGGTCACATATCGTCACTCTCTCTCCACCGTATGGGCATTT
GGGAAGCTCAAGCCTCAAACTCAACAGCTTTTGGAACTGATATCATTTCTTGATCCGGATTCCATCGGAGAAGAC
TTATTGGAAGCATCCGTGGAGCTGATTTCCGAGGGCACATCGTTTAAGAAAAGTAACTATATTGAGGCTCGAACT
GATCTCTTGCAATCATCTCTGGTCCAAAGAGATAAGCAAAAGCAGCAAATATCAGTTCATCGCATTGTGCAAGAT
GTGATACTAGCAACAATGGATGTTGAGAAGAAACGGTCCATGTTTGACCAAGTGAGTCTAACATTCTCCCGGTAT
CAAAAAGAGCGTGGACGGACAAAGCAATTTGATGGCTTCTTCGAAACTGCTCGCAGCATCCGCGAGTCCTCAACA
CACCCAGATCGGGATTCCCTGCTTGCAGATATCCATTTCTGCCTAGGAGCTATAGCCATGGATGCGAGCAATTTC
GGCACAAGCCGCATCCACAAGGAGCGTTCTTTTGATCTAGTTTCCAAAATTTGCAACGAACTTGGAACTGCAGAC
GACAGATTATACCTCGCCTACGCAGAACGAGGGATCTCACGGATCCAGGACGGACGGTACGAGGAAGGGGAGGCC
GACCTAAAGGAGGCGCTGCGGATACGCAAGGCTCTCGGTAACTACATTCCGCGGTCTGGCGAGGCCAACCTGAGC
TGGGCTCTCCTTTTGCAGGGCAAGTTGAAGAGTCCAACACACTTCTTCTGGATAGCCTGGCCGGCAGAGAAAAGG
CTTTAG
Gene >Pro_DTO377G3_2|g7723.t1
ATGGCTACGATGAGCTTTGCACCTACTGGCCACCTTCAGGTACTGCGGGATCCACCTGATGAATCTCAGGATGGC
ATCGAGTAAGAGAAACCCACAGACTGGCTCAGTTTAGGACCTCCACTTATTCTCAGTCTAGTATTGTTCTCGTTC
CTGGCATCGGAACTATCTTACCGGCAGAATGGCCGTTTGCCAAAGAAGAATGGCTTGCCACCCTACCAAGTTCCA
GTGCTGGGACACGCGTCCTCGCCTACGAATATGCTTCGCCATTTGCGACCGCCAAGCCTTCATGGGAGTCGATCT
TGATGCTAGGTCACGACCTTCTCCAGCATGTAAGCGACGGGCGATACTCAGACGCGGTAAAATTGATTACTTCCC
TTCGAACCATCCGTATACTTGCTAATTTACTTCCTCCAGACTGCCAACAAGCCAATCTTGATAGTCTGCCACAGC
TTAGGTGGTATTATAGTCAAACAGGCATTATGTGTCGCCAACAAGCAGTTTAACCGGTACGAATCAATTATCAAC
GCTATAGCTGGCGTTATCTTCCTAAGCACTCCGCATCGCTATGGCGACAAGACCACCAGTTTGATACGGTTTCGA
GATATATTTGAAGCGACGACCAGCAGAAACTTGAATATTCCAAGTACCAATATCGAGCAAGAAGGTGCCATTTTG
CTTGACCTTGCAGATAGATTCGAAAAAGTCTCATTCAGTACCCCCATACTATCCGCGTACGAACTGAGAGAATCG
AAAACCAGTTCGACTACACTGCAGCATAAATACCAACAAGTCAGTTTGAAGCCCTCGAATTAGGTCAACGCTAAC
TTCCAATATAGTTGGTCAACCGTGAAGCTTGTTCAACTCGCGCCCGAATGGAAACAGTCATTGGCCTTAATCTTA
ATCATCACGATACATGTCTTTTCACCCAGAGCGTTGGTGGCGAAAGTCTACCGGAGTTTAACAATTTTGTCTACA
ACACTTTGCGTGCCGCCGCGCGTCTTTTTGCTATTCAACTCAAGGACCGTAGGTTATGAACGCATCAGAAACCGC
AGAACGGTATTAATGGTCTCAGAGGAATCTCAAGATGCAACGACGAGCGCTTACTCCCCCACAATGAGCGAATTA
CCACTAAAATTTAAGCTGAATATCTACATATTACCAGGTTATCATAGATGTCGGTTAGTTGAGCAATTGGGACTC
ACGGAGTCGCCATCCAACAAAGCAACGGACGGAACATCTCTTTCGGGGTTTGAGTTGGTAACTCCTATAGCACCA
AAATCTGATATTGTGAAACCCCTCCACATACCATGCTTCCTTCTCAATACGCATTCAGCAAATCAGGATTTCTGC
GGCCGTGAAGATATCTTGGAACGTCTCGCAACCGAGCTCTTACCTCCAAAGAACAGAGTGACAGCATCGGGCACC
GCTATAAGGCAGTTTGCACTTTGTGGATTTGGAGGAATTGGAAAGACGGAAATAGCTCGCGAGTTTGCCCGGCGT
CACAAACATCCCTTTGATGCGGTATTCTGGGTCTTGGCGGATGAAGTTGCAAAACTTGATCACCATTACCAGCAA
ATATCGTTAGCACTAGGACTCGAAGAATCATCCGAGTGCAAAAGCCAGGTTGTCAGTAGAGAGATTGTGAAAGGG
TGGCTCTCTAATCCTCGAAAGCATATATCAGGGTCGGATGATTTTATTCAACCTGGCGAAGCTAGCTCGGAAGCA
ACTTGGTTGCTTATATTCGACAACGCAGATGAGCCAATAATTCTGGCAGACTACTGGCTCCAAGGCAGTGGATCG
ATTCTTATCACTAGTCGCGACCCTTTATGCAAAAACATGTTCACGGGAAGACCCTCAGGCTGGATTTAGGTCCAC
TTTCACAGCAAGACAGCCTATCCCTTTTCAACCACCTCACTACTGTCTCTAACGACCTAGAAGTTGACACAGCGC
AAAAAATTTCCGATGCACTTGGTGGAATGGCCATTTCTCAGATGGCTGGTATTATCCGTCGACAAGACCTCACTC
TTTCAGAGTTTTTTGAGCTGTATATGGACCATGAAGAACATGCCAGTCCTTATGAAACAAAGTTCGATACGAACT
TGGTCACATATCGTCACTCTCTCTCCACCGTATGGGCATTTGGGAAGCTCAAGCCTCAAACTCAACAGCTTTTGG
AACTGATATCATTTCTTGATCCGGATTCCATCGGAGAAGACTTATTGGAAGCATCCGTGGAGCTGATTTCCGAGG
GCACATCGTTTAAGAAAAGTAACTATATTGAGGCTCGAACTGATCTCTTGCAATCATCTCTGGTCCAAAGAGATA
AGCAAAAGCAGCAAATATCAGTTCATCGCATTGTGCAAGATGTGATACTAGCAACAATGGATGTTGAGAAGAAAC
GGTCCATGTTTGACCAAGTGGTACGAATTCTGTGGGCAGACTGGCCATCGGCTATGCCAAAGCCATCAAGGGAGC
CAGAGCTACCACAGCCCAAATCCTCTGGCAACAGGTTATATGTTGGAAGATGGCCTGCCTGTGCAGCGGTTTACC
CTCACGTTCTTAGGATGCATCAGCTCTGGCCAGCTATATCAGATTCCTCGGAGGCTACCAAATTGCTTTTCGCAA
AGTTACTGACTGATGCAGCATGGTGATTATACGATATTCAGGCATTTTATTTACTATAGAGTCTAACATTCTCCC
GGTATCAAAAAGAGCGTGGACGGACAAAGCAATTTGATGGCTTCTTCGAAACTGCTCGCAGCATCCGCGAGTCCT
CAACACACCCAGATCGGGATTCCCTGCTTGCAGATATCCATTTCTGCCTAGGAGCTATAGCCATGGATGCGAGCA
ATTTCGGCACAAGCCGCATCCACAAGGAGCGTTCTTTTGATCTAGTTTCCAAAATTTGCAACGAACTTGGAACTG
CAGACGACAGATTATACCTCGCCTACGCAGAACGAGGGATCTCACGGATCCAGGACGGACGGTACGAGGAAGGGG
AGGCCGACCTAAAGGAGGCGCTGCGGATACGCAAGGCTCTCGGTAACTACATTCCGCGGTCTGGCGAGGCCAACC
TGAGCTGGGCTCTCCTTTTGCAGGGCAAGTTGAAGAGTCCAACACACTTCTTCTGGATAGCCTGGCCGGCAGAGA
AAAGGCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail