Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7716.t1
Gene name
Locationscaffold_25:210959..215870
Strand-
Gene length (bp)4911
Transcript length (bp)4911
Coding sequence length (bp)4911
Protein length (aa) 1637

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 3.4E-69 1249 1503
PF16209 PhoLip_ATPase_N Phospholipid-translocating ATPase N-terminal 4.4E-23 275 333
PF00122 E1-E2_ATPase E1-E2 ATPase 2.4E-12 386 612
PF13246 Cation_ATPase Cation transport ATPase (P-type) 2.2E-09 789 871

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

Domain # Start End Length
1 312 334 22
2 545 567 22
3 580 602 22
4 1312 1334 22
5 1360 1382 22
6 1397 1414 17
7 1427 1446 19
8 1479 1501 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7716.t1
MSNDQSTEATEGTRPEQNNVLRRPSLASSHTISDSARRISSQHVRFSTDLDRESIEEQRQTDWDRRPNSRGLTVE
TALAPACVRPAPSPTSPLSPTNATQNATLSPIPSPNPEPAGRSRSRNRGYSLRRSIFNKTINSTEKDDLALAELG
EAKEPSSDVTPTQASAAETLTAVDEKHALSVAPMATLDSIHTEDASPYVSSDPLEKSPKEQFSVSVAHEKWLRKK
ATTAVAVARFQAVMASIQKFILRTKDIPPTQDGRHIDLNPSMVDSMIDERTQKPYIGNFIRSSRYSLWSFFPRQL
LAQFTKVANFYFLIIAILQMIPGLSTTGTYTTIVPLLIFVGISMGKEGFDDWRRYRLDKEENNRDAWVLRPGHGT
TQDGASMFSNTQDWERIKCEEIRVGDVIKLERDQPIPADIALLHATGPNGVAYIETMALDGETNLKNKKPCQPVS
KVCSTVEDINSNSLHFVVEDPNLDLYKFDGHVTVNGQEKLPLTNNEIVYRGSILRNTDRALGMVIYTGEECKIRM
NANKNPRIKRPALQDKVNRVVMLIVVLVIILAVVCTVAYKFWSRDVEQHSWYLQGASVSYGPIFTSFLIMFNTMI
PISLYVSMEIVKVAQMLLLNDIDMYDPETDTPLEARTSTINEELGQVSYIFSDKTGTLTNNSMRFRKMSVAGTAW
LHDADLQEEAARAGDHTKLIHKKRSAKGKKAMGRKSNVSEAQMPRPSNVSGHLDALRPYGRSATTYRTEEMLEYI
QRKPYTIFARKAKLFILSMALCHTCIPEQDINGNITFQAASPDELALVLAAQELGYLVVDRQSNTLTVRTQPNGP
DEATSDEVYEIMDVIEFSSARKRMSVVVRMPDQRICLFCKGADTTLMRLLKQADLARDKATEIERRASRRKNAEV
NQVIRRNSEHHSRKNSGVRNSMNRPSFSRRRSSITGQQGSALRASIDIWLRDRETDGGMRNKEADSEYYSPRPSA
QMGRPSAAISDSGSSTNGEEDEDLVEEALVVNEAAVFERCFQHLNDFATDGLRTLLYGHRFLDEATYTDWKTAYN
EASTSLVDRQQKIEDAGEQIEQQLELTGATAIEDKLQKGVPEAIDKLRRANIKMWMLTGDKRETAINVGHSCRLV
KEYSTLTILDQENGDVEETIAHLIGEITHGRVAHSVVVVDGQTLSLIEANEVVREQFFQLAVKADSVICCRASPK
QKAFLVRSIRKQLTDAITLAIGDGANDIAMIQEAHVGIGITGKEGLQAARISDYSIAQFRFLLKLLLVHGRWNYL
RACKYTLGTFWKEMLFYLTQALYQRWNGYTGTSLYEPWSLSMFNTLFTSLAVIFLGIFTKDLSAATLLAVPELYT
KGQRHGGFNIRLYLGWAFMATCEAVIIFFTMWSLFGLAKINPSDNDIFSMGLLTFSACIIVINVKLQALEVHNKT
YMSLIVIIISVGGWFMWDLILDREYTMSSGKGIYFLPSNFIHHSGHNLLFWTDLLLAVSAVLLFEFTVSTLRALF
FPTDVDIFQEYEQDLDIRKRFEEAAASELQQGWDHGTKRSSFEIARDNAEKVEMDARERQVRELLARPRVMDTKD
VEIDIASATVSHNSSVPSRDTENRGRQSGLYSEDTNRPRRSVEIQELFSKGYGSVRKGQLK*
Coding >Pro_DTO377G3_2|g7716.t1
ATGTCCAACGACCAATCTACGGAAGCTACAGAGGGTACCCGACCCGAGCAGAACAATGTCCTCCGACGCCCATCT
CTTGCGTCGTCACATACGATTTCCGACTCCGCGCGGCGGATCTCCTCCCAACATGTACGCTTCTCAACCGATCTC
GATCGCGAGTCGATCGAGGAACAACGACAGACAGATTGGGACCGTCGCCCCAATTCCCGCGGCCTGACCGTCGAA
ACAGCGCTGGCGCCTGCGTGTGTTCGACCTGCTCCCTCGCCCACCTCTCCGCTCTCACCTACCAATGCGACCCAA
AATGCGACTCTCTCCCCCATTCCCTCGCCAAATCCTGAGCCTGCAGGTCGGTCTCGGTCACGAAATCGTGGATAT
TCGCTCCGTCGCAGCATATTTAATAAGACAATCAATTCGACGGAGAAGGACGATCTCGCCCTAGCTGAGCTGGGG
GAGGCCAAGGAACCCTCGTCTGATGTGACTCCCACACAGGCTTCGGCTGCTGAGACGCTCACTGCCGTCGATGAG
AAGCATGCTCTGAGTGTCGCGCCGATGGCGACGCTCGACTCGATCCATACGGAGGATGCTTCCCCTTATGTCTCG
TCCGATCCTTTGGAGAAGTCTCCCAAGGAGCAGTTCTCCGTGTCTGTGGCCCATGAGAAGTGGCTCCGGAAAAAG
GCGACTACTGCAGTGGCAGTCGCGCGTTTCCAGGCTGTTATGGCATCTATCCAGAAATTCATTCTCCGAACCAAG
GATATTCCTCCTACTCAGGATGGGCGCCACATTGACTTGAATCCGTCTATGGTGGATTCTATGATTGATGAGCGC
ACCCAGAAGCCTTATATCGGTAACTTCATTCGTTCGAGTCGTTACAGTCTCTGGAGTTTCTTCCCCCGCCAATTA
TTGGCCCAATTCACCAAAGTCGCCAACTTCTACTTCTTGATTATCGCCATCTTGCAGATGATCCCTGGCTTGAGT
ACAACTGGAACATACACGACCATCGTTCCGCTTTTGATCTTCGTTGGCATATCAATGGGAAAGGAGGGGTTCGAT
GATTGGCGCCGGTATCGTTTGGACAAGGAAGAGAATAATCGGGATGCTTGGGTGCTCCGCCCAGGCCACGGCACG
ACCCAGGACGGAGCCTCCATGTTCAGCAATACTCAAGATTGGGAGCGGATCAAGTGTGAGGAAATTCGTGTTGGA
GATGTTATAAAACTTGAGCGCGACCAGCCGATTCCCGCTGATATTGCTCTCCTCCACGCCACCGGACCCAACGGT
GTCGCTTACATCGAGACCATGGCTCTTGACGGCGAGACAAACTTGAAAAATAAGAAGCCTTGCCAGCCTGTGTCT
AAGGTGTGCTCAACCGTGGAGGATATCAACAGCAACTCCTTGCACTTTGTCGTTGAGGACCCCAACTTGGATCTA
TATAAGTTCGACGGTCATGTCACTGTCAATGGCCAGGAGAAACTGCCCTTGACCAACAACGAGATTGTTTACCGC
GGCAGCATTCTTCGGAACACTGACCGCGCTTTGGGTATGGTGATATATACTGGCGAGGAGTGCAAGATCCGCATG
AACGCCAACAAGAACCCGCGAATCAAGAGGCCCGCTCTCCAGGATAAGGTTAACCGTGTGGTAATGCTGATCGTG
GTGTTGGTCATTATTCTAGCCGTTGTTTGTACCGTGGCCTACAAGTTCTGGTCTCGCGACGTGGAGCAACATTCT
TGGTACCTTCAAGGTGCTAGTGTCTCCTACGGCCCGATCTTCACTTCGTTCCTGATTATGTTCAACACTATGATT
CCCATCTCCCTGTACGTGAGTATGGAAATCGTCAAAGTTGCCCAGATGCTGCTCTTGAACGATATCGACATGTAC
GATCCTGAAACCGACACCCCGCTTGAAGCGCGCACATCTACCATCAACGAGGAGCTCGGTCAAGTCAGCTACATC
TTCTCTGACAAGACTGGTACCCTGACAAATAACTCGATGCGGTTCCGCAAGATGAGTGTGGCTGGAACCGCGTGG
TTGCATGACGCGGACCTCCAGGAGGAGGCTGCTCGTGCAGGCGACCACACCAAGTTGATCCACAAAAAGCGGAGC
GCAAAGGGGAAAAAGGCAATGGGACGCAAGTCCAATGTTTCCGAGGCTCAGATGCCCCGTCCGTCGAATGTTTCT
GGACACCTTGATGCTCTCCGTCCGTATGGCCGGTCGGCTACTACGTACCGCACCGAAGAGATGCTCGAATATATC
CAACGCAAGCCGTACACCATTTTTGCCCGAAAGGCCAAACTGTTTATTCTGTCCATGGCACTGTGTCACACTTGC
ATTCCCGAGCAAGACATAAACGGAAACATCACTTTCCAGGCTGCTTCCCCGGATGAGTTAGCTCTTGTTCTTGCA
GCGCAGGAACTCGGATATCTCGTCGTGGATCGTCAATCAAACACGTTGACCGTCCGCACACAACCGAACGGACCA
GATGAAGCCACTAGCGACGAAGTCTACGAGATCATGGACGTGATCGAGTTTTCAAGCGCGCGAAAGCGCATGTCA
GTCGTCGTGCGTATGCCCGACCAACGCATTTGCCTATTCTGCAAGGGTGCCGATACCACACTGATGCGTCTCCTG
AAGCAAGCCGATCTGGCACGTGATAAGGCGACTGAGATCGAGCGCCGTGCAAGCAGACGCAAGAATGCCGAGGTG
AACCAGGTGATCCGACGTAACAGCGAGCACCACAGCCGAAAGAACAGTGGTGTTCGGAACAGTATGAACCGGCCT
AGCTTCAGCCGTCGCCGCTCGTCGATCACTGGCCAACAGGGCTCGGCTCTTCGAGCTAGTATCGATATTTGGCTG
CGTGACCGGGAGACGGATGGGGGTATGCGGAACAAAGAGGCTGATAGTGAGTACTACAGCCCTCGGCCATCGGCG
CAGATGGGCAGACCGTCCGCTGCGATCTCGGACTCTGGAAGCTCTACGAATGGTGAAGAAGACGAGGATCTCGTG
GAAGAGGCATTGGTTGTCAACGAAGCGGCTGTTTTCGAGCGCTGCTTCCAGCATTTGAATGACTTTGCCACTGAC
GGCCTGCGGACTTTGTTGTATGGCCACCGATTCTTGGATGAAGCGACCTACACGGATTGGAAGACTGCTTACAAT
GAGGCTAGCACTAGCCTCGTTGATCGGCAGCAGAAAATTGAAGACGCCGGCGAGCAGATTGAGCAGCAGCTGGAG
CTTACTGGGGCCACTGCTATTGAGGATAAGCTGCAAAAGGGCGTGCCAGAGGCTATTGACAAATTGCGACGAGCC
AATATCAAGATGTGGATGTTGACCGGTGATAAGCGGGAGACTGCTATCAATGTCGGCCATTCGTGTCGTCTTGTC
AAGGAGTACTCGACACTGACAATTTTGGATCAAGAAAATGGCGACGTTGAGGAGACAATCGCGCATCTTATTGGG
GAGATTACCCATGGCCGCGTGGCGCATTCTGTAGTTGTGGTTGATGGCCAGACGCTATCGTTGATCGAAGCAAAT
GAGGTGGTGCGTGAGCAGTTCTTCCAACTGGCTGTCAAGGCAGACTCGGTCATTTGTTGCCGAGCGAGCCCGAAG
CAAAAGGCGTTCTTGGTGAGATCAATCCGCAAACAGCTCACCGACGCAATAACGCTTGCTATTGGAGATGGCGCC
AACGATATCGCCATGATCCAGGAGGCCCATGTGGGTATCGGCATCACTGGAAAGGAGGGATTGCAGGCAGCACGT
ATTTCAGACTACTCGATCGCGCAGTTCCGCTTCCTTCTCAAGCTGCTTCTGGTGCACGGCCGGTGGAACTATCTG
CGTGCTTGCAAGTATACACTCGGCACGTTCTGGAAGGAAATGCTGTTTTACCTGACTCAAGCGCTGTACCAGCGT
TGGAACGGCTACACTGGCACCAGTTTGTATGAGCCGTGGAGTCTGAGTATGTTCAACACGCTGTTCACCTCGCTC
GCTGTCATCTTCTTGGGTATCTTCACCAAAGACCTCTCAGCAGCAACACTACTGGCCGTGCCAGAGCTCTACACC
AAGGGTCAAAGGCACGGAGGCTTCAATATCCGGCTCTATCTGGGCTGGGCATTCATGGCGACGTGCGAAGCAGTG
ATAATCTTCTTTACTATGTGGAGTCTTTTCGGCCTGGCAAAAATCAACCCCAGCGACAACGACATTTTCTCCATG
GGCCTACTCACCTTCTCCGCGTGCATCATCGTGATCAACGTGAAACTCCAGGCTCTGGAAGTCCACAACAAAACC
TACATGTCGCTAATTGTAATAATAATTTCCGTCGGCGGCTGGTTCATGTGGGACCTAATCCTCGACCGTGAATAC
ACAATGTCCTCCGGCAAAGGCATCTACTTCCTCCCGTCCAACTTCATCCATCACTCCGGCCACAACCTGCTCTTC
TGGACCGACCTCCTCCTCGCCGTCTCAGCAGTCCTCCTCTTTGAATTCACAGTCTCAACCCTCCGCGCCCTCTTC
TTCCCAACAGACGTCGACATCTTTCAAGAATACGAACAAGACCTCGACATCCGCAAGCGCTTCGAAGAAGCAGCT
GCCTCGGAGCTCCAGCAGGGCTGGGACCACGGTACCAAGAGATCAAGCTTCGAGATCGCCCGCGACAACGCCGAG
AAGGTTGAAATGGACGCCCGCGAACGCCAGGTCCGCGAGCTGCTCGCGCGCCCTCGTGTCATGGATACCAAGGAT
GTCGAGATCGATATTGCCAGCGCCACGGTTAGTCATAATAGCAGCGTGCCGAGTCGTGATACTGAAAACCGTGGT
CGCCAATCTGGCCTCTATTCCGAAGACACTAATAGGCCTCGGCGTTCTGTTGAGATCCAGGAGCTCTTTAGTAAG
GGCTATGGTTCTGTGCGCAAGGGTCAACTCAAATGA
Transcript >Pro_DTO377G3_2|g7716.t1
ATGTCCAACGACCAATCTACGGAAGCTACAGAGGGTACCCGACCCGAGCAGAACAATGTCCTCCGACGCCCATCT
CTTGCGTCGTCACATACGATTTCCGACTCCGCGCGGCGGATCTCCTCCCAACATGTACGCTTCTCAACCGATCTC
GATCGCGAGTCGATCGAGGAACAACGACAGACAGATTGGGACCGTCGCCCCAATTCCCGCGGCCTGACCGTCGAA
ACAGCGCTGGCGCCTGCGTGTGTTCGACCTGCTCCCTCGCCCACCTCTCCGCTCTCACCTACCAATGCGACCCAA
AATGCGACTCTCTCCCCCATTCCCTCGCCAAATCCTGAGCCTGCAGGTCGGTCTCGGTCACGAAATCGTGGATAT
TCGCTCCGTCGCAGCATATTTAATAAGACAATCAATTCGACGGAGAAGGACGATCTCGCCCTAGCTGAGCTGGGG
GAGGCCAAGGAACCCTCGTCTGATGTGACTCCCACACAGGCTTCGGCTGCTGAGACGCTCACTGCCGTCGATGAG
AAGCATGCTCTGAGTGTCGCGCCGATGGCGACGCTCGACTCGATCCATACGGAGGATGCTTCCCCTTATGTCTCG
TCCGATCCTTTGGAGAAGTCTCCCAAGGAGCAGTTCTCCGTGTCTGTGGCCCATGAGAAGTGGCTCCGGAAAAAG
GCGACTACTGCAGTGGCAGTCGCGCGTTTCCAGGCTGTTATGGCATCTATCCAGAAATTCATTCTCCGAACCAAG
GATATTCCTCCTACTCAGGATGGGCGCCACATTGACTTGAATCCGTCTATGGTGGATTCTATGATTGATGAGCGC
ACCCAGAAGCCTTATATCGGTAACTTCATTCGTTCGAGTCGTTACAGTCTCTGGAGTTTCTTCCCCCGCCAATTA
TTGGCCCAATTCACCAAAGTCGCCAACTTCTACTTCTTGATTATCGCCATCTTGCAGATGATCCCTGGCTTGAGT
ACAACTGGAACATACACGACCATCGTTCCGCTTTTGATCTTCGTTGGCATATCAATGGGAAAGGAGGGGTTCGAT
GATTGGCGCCGGTATCGTTTGGACAAGGAAGAGAATAATCGGGATGCTTGGGTGCTCCGCCCAGGCCACGGCACG
ACCCAGGACGGAGCCTCCATGTTCAGCAATACTCAAGATTGGGAGCGGATCAAGTGTGAGGAAATTCGTGTTGGA
GATGTTATAAAACTTGAGCGCGACCAGCCGATTCCCGCTGATATTGCTCTCCTCCACGCCACCGGACCCAACGGT
GTCGCTTACATCGAGACCATGGCTCTTGACGGCGAGACAAACTTGAAAAATAAGAAGCCTTGCCAGCCTGTGTCT
AAGGTGTGCTCAACCGTGGAGGATATCAACAGCAACTCCTTGCACTTTGTCGTTGAGGACCCCAACTTGGATCTA
TATAAGTTCGACGGTCATGTCACTGTCAATGGCCAGGAGAAACTGCCCTTGACCAACAACGAGATTGTTTACCGC
GGCAGCATTCTTCGGAACACTGACCGCGCTTTGGGTATGGTGATATATACTGGCGAGGAGTGCAAGATCCGCATG
AACGCCAACAAGAACCCGCGAATCAAGAGGCCCGCTCTCCAGGATAAGGTTAACCGTGTGGTAATGCTGATCGTG
GTGTTGGTCATTATTCTAGCCGTTGTTTGTACCGTGGCCTACAAGTTCTGGTCTCGCGACGTGGAGCAACATTCT
TGGTACCTTCAAGGTGCTAGTGTCTCCTACGGCCCGATCTTCACTTCGTTCCTGATTATGTTCAACACTATGATT
CCCATCTCCCTGTACGTGAGTATGGAAATCGTCAAAGTTGCCCAGATGCTGCTCTTGAACGATATCGACATGTAC
GATCCTGAAACCGACACCCCGCTTGAAGCGCGCACATCTACCATCAACGAGGAGCTCGGTCAAGTCAGCTACATC
TTCTCTGACAAGACTGGTACCCTGACAAATAACTCGATGCGGTTCCGCAAGATGAGTGTGGCTGGAACCGCGTGG
TTGCATGACGCGGACCTCCAGGAGGAGGCTGCTCGTGCAGGCGACCACACCAAGTTGATCCACAAAAAGCGGAGC
GCAAAGGGGAAAAAGGCAATGGGACGCAAGTCCAATGTTTCCGAGGCTCAGATGCCCCGTCCGTCGAATGTTTCT
GGACACCTTGATGCTCTCCGTCCGTATGGCCGGTCGGCTACTACGTACCGCACCGAAGAGATGCTCGAATATATC
CAACGCAAGCCGTACACCATTTTTGCCCGAAAGGCCAAACTGTTTATTCTGTCCATGGCACTGTGTCACACTTGC
ATTCCCGAGCAAGACATAAACGGAAACATCACTTTCCAGGCTGCTTCCCCGGATGAGTTAGCTCTTGTTCTTGCA
GCGCAGGAACTCGGATATCTCGTCGTGGATCGTCAATCAAACACGTTGACCGTCCGCACACAACCGAACGGACCA
GATGAAGCCACTAGCGACGAAGTCTACGAGATCATGGACGTGATCGAGTTTTCAAGCGCGCGAAAGCGCATGTCA
GTCGTCGTGCGTATGCCCGACCAACGCATTTGCCTATTCTGCAAGGGTGCCGATACCACACTGATGCGTCTCCTG
AAGCAAGCCGATCTGGCACGTGATAAGGCGACTGAGATCGAGCGCCGTGCAAGCAGACGCAAGAATGCCGAGGTG
AACCAGGTGATCCGACGTAACAGCGAGCACCACAGCCGAAAGAACAGTGGTGTTCGGAACAGTATGAACCGGCCT
AGCTTCAGCCGTCGCCGCTCGTCGATCACTGGCCAACAGGGCTCGGCTCTTCGAGCTAGTATCGATATTTGGCTG
CGTGACCGGGAGACGGATGGGGGTATGCGGAACAAAGAGGCTGATAGTGAGTACTACAGCCCTCGGCCATCGGCG
CAGATGGGCAGACCGTCCGCTGCGATCTCGGACTCTGGAAGCTCTACGAATGGTGAAGAAGACGAGGATCTCGTG
GAAGAGGCATTGGTTGTCAACGAAGCGGCTGTTTTCGAGCGCTGCTTCCAGCATTTGAATGACTTTGCCACTGAC
GGCCTGCGGACTTTGTTGTATGGCCACCGATTCTTGGATGAAGCGACCTACACGGATTGGAAGACTGCTTACAAT
GAGGCTAGCACTAGCCTCGTTGATCGGCAGCAGAAAATTGAAGACGCCGGCGAGCAGATTGAGCAGCAGCTGGAG
CTTACTGGGGCCACTGCTATTGAGGATAAGCTGCAAAAGGGCGTGCCAGAGGCTATTGACAAATTGCGACGAGCC
AATATCAAGATGTGGATGTTGACCGGTGATAAGCGGGAGACTGCTATCAATGTCGGCCATTCGTGTCGTCTTGTC
AAGGAGTACTCGACACTGACAATTTTGGATCAAGAAAATGGCGACGTTGAGGAGACAATCGCGCATCTTATTGGG
GAGATTACCCATGGCCGCGTGGCGCATTCTGTAGTTGTGGTTGATGGCCAGACGCTATCGTTGATCGAAGCAAAT
GAGGTGGTGCGTGAGCAGTTCTTCCAACTGGCTGTCAAGGCAGACTCGGTCATTTGTTGCCGAGCGAGCCCGAAG
CAAAAGGCGTTCTTGGTGAGATCAATCCGCAAACAGCTCACCGACGCAATAACGCTTGCTATTGGAGATGGCGCC
AACGATATCGCCATGATCCAGGAGGCCCATGTGGGTATCGGCATCACTGGAAAGGAGGGATTGCAGGCAGCACGT
ATTTCAGACTACTCGATCGCGCAGTTCCGCTTCCTTCTCAAGCTGCTTCTGGTGCACGGCCGGTGGAACTATCTG
CGTGCTTGCAAGTATACACTCGGCACGTTCTGGAAGGAAATGCTGTTTTACCTGACTCAAGCGCTGTACCAGCGT
TGGAACGGCTACACTGGCACCAGTTTGTATGAGCCGTGGAGTCTGAGTATGTTCAACACGCTGTTCACCTCGCTC
GCTGTCATCTTCTTGGGTATCTTCACCAAAGACCTCTCAGCAGCAACACTACTGGCCGTGCCAGAGCTCTACACC
AAGGGTCAAAGGCACGGAGGCTTCAATATCCGGCTCTATCTGGGCTGGGCATTCATGGCGACGTGCGAAGCAGTG
ATAATCTTCTTTACTATGTGGAGTCTTTTCGGCCTGGCAAAAATCAACCCCAGCGACAACGACATTTTCTCCATG
GGCCTACTCACCTTCTCCGCGTGCATCATCGTGATCAACGTGAAACTCCAGGCTCTGGAAGTCCACAACAAAACC
TACATGTCGCTAATTGTAATAATAATTTCCGTCGGCGGCTGGTTCATGTGGGACCTAATCCTCGACCGTGAATAC
ACAATGTCCTCCGGCAAAGGCATCTACTTCCTCCCGTCCAACTTCATCCATCACTCCGGCCACAACCTGCTCTTC
TGGACCGACCTCCTCCTCGCCGTCTCAGCAGTCCTCCTCTTTGAATTCACAGTCTCAACCCTCCGCGCCCTCTTC
TTCCCAACAGACGTCGACATCTTTCAAGAATACGAACAAGACCTCGACATCCGCAAGCGCTTCGAAGAAGCAGCT
GCCTCGGAGCTCCAGCAGGGCTGGGACCACGGTACCAAGAGATCAAGCTTCGAGATCGCCCGCGACAACGCCGAG
AAGGTTGAAATGGACGCCCGCGAACGCCAGGTCCGCGAGCTGCTCGCGCGCCCTCGTGTCATGGATACCAAGGAT
GTCGAGATCGATATTGCCAGCGCCACGGTTAGTCATAATAGCAGCGTGCCGAGTCGTGATACTGAAAACCGTGGT
CGCCAATCTGGCCTCTATTCCGAAGACACTAATAGGCCTCGGCGTTCTGTTGAGATCCAGGAGCTCTTTAGTAAG
GGCTATGGTTCTGTGCGCAAGGGTCAACTCAAATGA
Gene >Pro_DTO377G3_2|g7716.t1
ATGTCCAACGACCAATCTACGGAAGCTACAGAGGGTACCCGACCCGAGCAGAACAATGTCCTCCGACGCCCATCT
CTTGCGTCGTCACATACGATTTCCGACTCCGCGCGGCGGATCTCCTCCCAACATGTACGCTTCTCAACCGATCTC
GATCGCGAGTCGATCGAGGAACAACGACAGACAGATTGGGACCGTCGCCCCAATTCCCGCGGCCTGACCGTCGAA
ACAGCGCTGGCGCCTGCGTGTGTTCGACCTGCTCCCTCGCCCACCTCTCCGCTCTCACCTACCAATGCGACCCAA
AATGCGACTCTCTCCCCCATTCCCTCGCCAAATCCTGAGCCTGCAGGTCGGTCTCGGTCACGAAATCGTGGATAT
TCGCTCCGTCGCAGCATATTTAATAAGACAATCAATTCGACGGAGAAGGACGATCTCGCCCTAGCTGAGCTGGGG
GAGGCCAAGGAACCCTCGTCTGATGTGACTCCCACACAGGCTTCGGCTGCTGAGACGCTCACTGCCGTCGATGAG
AAGCATGCTCTGAGTGTCGCGCCGATGGCGACGCTCGACTCGATCCATACGGAGGATGCTTCCCCTTATGTCTCG
TCCGATCCTTTGGAGAAGTCTCCCAAGGAGCAGTTCTCCGTGTCTGTGGCCCATGAGAAGTGGCTCCGGAAAAAG
GCGACTACTGCAGTGGCAGTCGCGCGTTTCCAGGCTGTTATGGCATCTATCCAGAAATTCATTCTCCGAACCAAG
GATATTCCTCCTACTCAGGATGGGCGCCACATTGACTTGAATCCGTCTATGGTGGATTCTATGATTGATGAGCGC
ACCCAGAAGCCTTATATCGGTAACTTCATTCGTTCGAGTCGTTACAGTCTCTGGAGTTTCTTCCCCCGCCAATTA
TTGGCCCAATTCACCAAAGTCGCCAACTTCTACTTCTTGATTATCGCCATCTTGCAGATGATCCCTGGCTTGAGT
ACAACTGGAACATACACGACCATCGTTCCGCTTTTGATCTTCGTTGGCATATCAATGGGAAAGGAGGGGTTCGAT
GATTGGCGCCGGTATCGTTTGGACAAGGAAGAGAATAATCGGGATGCTTGGGTGCTCCGCCCAGGCCACGGCACG
ACCCAGGACGGAGCCTCCATGTTCAGCAATACTCAAGATTGGGAGCGGATCAAGTGTGAGGAAATTCGTGTTGGA
GATGTTATAAAACTTGAGCGCGACCAGCCGATTCCCGCTGATATTGCTCTCCTCCACGCCACCGGACCCAACGGT
GTCGCTTACATCGAGACCATGGCTCTTGACGGCGAGACAAACTTGAAAAATAAGAAGCCTTGCCAGCCTGTGTCT
AAGGTGTGCTCAACCGTGGAGGATATCAACAGCAACTCCTTGCACTTTGTCGTTGAGGACCCCAACTTGGATCTA
TATAAGTTCGACGGTCATGTCACTGTCAATGGCCAGGAGAAACTGCCCTTGACCAACAACGAGATTGTTTACCGC
GGCAGCATTCTTCGGAACACTGACCGCGCTTTGGGTATGGTGATATATACTGGCGAGGAGTGCAAGATCCGCATG
AACGCCAACAAGAACCCGCGAATCAAGAGGCCCGCTCTCCAGGATAAGGTTAACCGTGTGGTAATGCTGATCGTG
GTGTTGGTCATTATTCTAGCCGTTGTTTGTACCGTGGCCTACAAGTTCTGGTCTCGCGACGTGGAGCAACATTCT
TGGTACCTTCAAGGTGCTAGTGTCTCCTACGGCCCGATCTTCACTTCGTTCCTGATTATGTTCAACACTATGATT
CCCATCTCCCTGTACGTGAGTATGGAAATCGTCAAAGTTGCCCAGATGCTGCTCTTGAACGATATCGACATGTAC
GATCCTGAAACCGACACCCCGCTTGAAGCGCGCACATCTACCATCAACGAGGAGCTCGGTCAAGTCAGCTACATC
TTCTCTGACAAGACTGGTACCCTGACAAATAACTCGATGCGGTTCCGCAAGATGAGTGTGGCTGGAACCGCGTGG
TTGCATGACGCGGACCTCCAGGAGGAGGCTGCTCGTGCAGGCGACCACACCAAGTTGATCCACAAAAAGCGGAGC
GCAAAGGGGAAAAAGGCAATGGGACGCAAGTCCAATGTTTCCGAGGCTCAGATGCCCCGTCCGTCGAATGTTTCT
GGACACCTTGATGCTCTCCGTCCGTATGGCCGGTCGGCTACTACGTACCGCACCGAAGAGATGCTCGAATATATC
CAACGCAAGCCGTACACCATTTTTGCCCGAAAGGCCAAACTGTTTATTCTGTCCATGGCACTGTGTCACACTTGC
ATTCCCGAGCAAGACATAAACGGAAACATCACTTTCCAGGCTGCTTCCCCGGATGAGTTAGCTCTTGTTCTTGCA
GCGCAGGAACTCGGATATCTCGTCGTGGATCGTCAATCAAACACGTTGACCGTCCGCACACAACCGAACGGACCA
GATGAAGCCACTAGCGACGAAGTCTACGAGATCATGGACGTGATCGAGTTTTCAAGCGCGCGAAAGCGCATGTCA
GTCGTCGTGCGTATGCCCGACCAACGCATTTGCCTATTCTGCAAGGGTGCCGATACCACACTGATGCGTCTCCTG
AAGCAAGCCGATCTGGCACGTGATAAGGCGACTGAGATCGAGCGCCGTGCAAGCAGACGCAAGAATGCCGAGGTG
AACCAGGTGATCCGACGTAACAGCGAGCACCACAGCCGAAAGAACAGTGGTGTTCGGAACAGTATGAACCGGCCT
AGCTTCAGCCGTCGCCGCTCGTCGATCACTGGCCAACAGGGCTCGGCTCTTCGAGCTAGTATCGATATTTGGCTG
CGTGACCGGGAGACGGATGGGGGTATGCGGAACAAAGAGGCTGATAGTGAGTACTACAGCCCTCGGCCATCGGCG
CAGATGGGCAGACCGTCCGCTGCGATCTCGGACTCTGGAAGCTCTACGAATGGTGAAGAAGACGAGGATCTCGTG
GAAGAGGCATTGGTTGTCAACGAAGCGGCTGTTTTCGAGCGCTGCTTCCAGCATTTGAATGACTTTGCCACTGAC
GGCCTGCGGACTTTGTTGTATGGCCACCGATTCTTGGATGAAGCGACCTACACGGATTGGAAGACTGCTTACAAT
GAGGCTAGCACTAGCCTCGTTGATCGGCAGCAGAAAATTGAAGACGCCGGCGAGCAGATTGAGCAGCAGCTGGAG
CTTACTGGGGCCACTGCTATTGAGGATAAGCTGCAAAAGGGCGTGCCAGAGGCTATTGACAAATTGCGACGAGCC
AATATCAAGATGTGGATGTTGACCGGTGATAAGCGGGAGACTGCTATCAATGTCGGCCATTCGTGTCGTCTTGTC
AAGGAGTACTCGACACTGACAATTTTGGATCAAGAAAATGGCGACGTTGAGGAGACAATCGCGCATCTTATTGGG
GAGATTACCCATGGCCGCGTGGCGCATTCTGTAGTTGTGGTTGATGGCCAGACGCTATCGTTGATCGAAGCAAAT
GAGGTGGTGCGTGAGCAGTTCTTCCAACTGGCTGTCAAGGCAGACTCGGTCATTTGTTGCCGAGCGAGCCCGAAG
CAAAAGGCGTTCTTGGTGAGATCAATCCGCAAACAGCTCACCGACGCAATAACGCTTGCTATTGGAGATGGCGCC
AACGATATCGCCATGATCCAGGAGGCCCATGTGGGTATCGGCATCACTGGAAAGGAGGGATTGCAGGCAGCACGT
ATTTCAGACTACTCGATCGCGCAGTTCCGCTTCCTTCTCAAGCTGCTTCTGGTGCACGGCCGGTGGAACTATCTG
CGTGCTTGCAAGTATACACTCGGCACGTTCTGGAAGGAAATGCTGTTTTACCTGACTCAAGCGCTGTACCAGCGT
TGGAACGGCTACACTGGCACCAGTTTGTATGAGCCGTGGAGTCTGAGTATGTTCAACACGCTGTTCACCTCGCTC
GCTGTCATCTTCTTGGGTATCTTCACCAAAGACCTCTCAGCAGCAACACTACTGGCCGTGCCAGAGCTCTACACC
AAGGGTCAAAGGCACGGAGGCTTCAATATCCGGCTCTATCTGGGCTGGGCATTCATGGCGACGTGCGAAGCAGTG
ATAATCTTCTTTACTATGTGGAGTCTTTTCGGCCTGGCAAAAATCAACCCCAGCGACAACGACATTTTCTCCATG
GGCCTACTCACCTTCTCCGCGTGCATCATCGTGATCAACGTGAAACTCCAGGCTCTGGAAGTCCACAACAAAACC
TACATGTCGCTAATTGTAATAATAATTTCCGTCGGCGGCTGGTTCATGTGGGACCTAATCCTCGACCGTGAATAC
ACAATGTCCTCCGGCAAAGGCATCTACTTCCTCCCGTCCAACTTCATCCATCACTCCGGCCACAACCTGCTCTTC
TGGACCGACCTCCTCCTCGCCGTCTCAGCAGTCCTCCTCTTTGAATTCACAGTCTCAACCCTCCGCGCCCTCTTC
TTCCCAACAGACGTCGACATCTTTCAAGAATACGAACAAGACCTCGACATCCGCAAGCGCTTCGAAGAAGCAGCT
GCCTCGGAGCTCCAGCAGGGCTGGGACCACGGTACCAAGAGATCAAGCTTCGAGATCGCCCGCGACAACGCCGAG
AAGGTTGAAATGGACGCCCGCGAACGCCAGGTCCGCGAGCTGCTCGCGCGCCCTCGTGTCATGGATACCAAGGAT
GTCGAGATCGATATTGCCAGCGCCACGGTTAGTCATAATAGCAGCGTGCCGAGTCGTGATACTGAAAACCGTGGT
CGCCAATCTGGCCTCTATTCCGAAGACACTAATAGGCCTCGGCGTTCTGTTGAGATCCAGGAGCTCTTTAGTAAG
GGCTATGGTTCTGTGCGCAAGGGTCAACTCAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail