Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7705.t1
Gene name
Locationscaffold_25:188412..188930
Strand-
Gene length (bp)518
Transcript length (bp)318
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 52 74 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 12.85 1.13 24.57
5d_25C Five days - 25 degrees Celsius 10.70 0.13 21.26
7d_25C Seven days - 25 degrees Celsius 9.14 0.00 18.46
10d_25C Ten days - 25 degrees Celsius 3.52 0.00 7.93
7d_15C Seven days - 15 degrees Celsius 7.23 0.00 14.86
7d_30C Seven days - 30 degrees Celsius 12.22 0.17 24.27

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.802405 no
3d_25C 7d_25C 0.597544 no
3d_25C 7d_15C 0.326676 no
3d_25C 7d_30C 0.953867 no
3d_25C 10d_25C 0.056880 no
5d_25C 7d_25C 0.846277 no
5d_25C 7d_15C 0.581978 no
5d_25C 7d_30C 0.871018 no
5d_25C 10d_25C 0.106191 no
7d_25C 7d_15C 0.757578 no
7d_25C 7d_30C 0.684364 no
7d_25C 10d_25C 0.166029 no
7d_15C 7d_30C 0.406941 no
7d_15C 10d_25C 0.312718 no
7d_30C 10d_25C 0.069111 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7705.t1
MNWPGDDGDRSNYDLFVRPLMADLKAYAAVDRLIYSDTQNLLMPALIKFNSLGLRLLIAPCLAIPCGPTGFPILQ
AMTLFQSTLLKSYGLPGRQISINEYANMAE*
Coding >Pro_DTO377G3_2|g7705.t1
ATGAACTGGCCTGGCGACGACGGAGACCGGTCAAACTATGACCTCTTTGTGAGGCCTTTGATGGCCGATCTCAAG
GCATACGCAGCAGTTGATCGACTTATATATTCGGACACGCAAAATCTTTTGATGCCGGCTTTGATCAAGTTCAAC
TCTCTGGGCCTACGCTTGCTTATAGCCCCGTGTCTGGCAATACCTTGTGGGCCAACTGGCTTCCCCATATTGCAG
GCAATGACACTATTCCAGAGCACGCTACTGAAGAGCTACGGCCTTCCTGGGCGTCAAATCAGCATCAATGAGTAC
GCCAACATGGCTGAATAG
Transcript >Pro_DTO377G3_2|g7705.t1
ATGAACTGGCCTGGCGACGACGGAGACCGGTCAAACTATGACCTCTTTGTGAGGCCTTTGATGGCCGATCTCAAG
GCATACGCAGCAGTTGATCGACTTATATATTCGGACACGCAAAATCTTTTGATGCCGGCTTTGATCAAGTTCAAC
TCTCTGGGCCTACGCTTGCTTATAGCCCCGTGTCTGGCAATACCTTGTGGGCCAACTGGCTTCCCCATATTGCAG
GCAATGACACTATTCCAGAGCACGCTACTGAAGAGCTACGGCCTTCCTGGGCGTCAAATCAGCATCAATGAGTAC
GCCAACATGGCTGAATAG
Gene >Pro_DTO377G3_2|g7705.t1
ATGAACTGGCCTGGCGACGACGGAGACCGGTCAAACTATGACCTCTTTGTGAGGCCTTTGATGGCCGATCTCAAG
GCATACGGTGCTCTCAAAGGGCTTGTTTGGGACATTTGGAATGAACCAGACAATGAGAACTTTTGGGTTCGCTCC
CAGCAGCAGTTGATCGACTTATATATTCGGACACGCAAAATCTTTTGGTAAGTGGTTCTTTTTTAAGAAATCTGG
GCGAGTTGCTAATACGCAGATATTGAAGATGCCGGCTTTGATCAAGTTCAACTCTCTGGGCCTACGCTTGCTTAT
AGCCCCGTGTCTGGCAATACCTTGTGGGCCAACTGGCTTCCCCATATTGCAGGCAATGACACTATTCCAGAGCAG
TACGCATATCACTTAGAAGGAGGGACGGGTGATTGGGACAATGATATTCAAAACACAAACGTACTTTGACAGCGC
TACTGAAGAGCTACGGCCTTCCTGGGCGTCAAATCAGCATCAATGAGTACGCCAACATGGCTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail