Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7674.t1
Gene name
Locationscaffold_25:87863..88706
Strand+
Gene length (bp)843
Transcript length (bp)450
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00036 EF-hand_1 EF hand 3.9E-09 12 40
PF00036 EF-hand_1 EF hand 1.2E-08 48 75
PF00036 EF-hand_1 EF hand 2.8E-09 85 112
PF00036 EF-hand_1 EF hand 7.9E-10 121 147
PF13499 EF-hand_7 EF-hand domain pair 4.4E-15 13 73
PF13499 EF-hand_7 EF-hand domain pair 3.9E-19 83 146
PF13833 EF-hand_8 EF-hand domain pair 2.1E-14 25 75
PF13833 EF-hand_8 EF-hand domain pair 1.2E-03 82 104
PF13833 EF-hand_8 EF-hand domain pair 2.4E-15 98 146
PF13405 EF-hand_6 EF-hand domain 7.2E-09 13 41
PF13405 EF-hand_6 EF-hand domain 8.1E-09 85 114
PF13202 EF-hand_5 EF hand 4.7E-06 15 37
PF13202 EF-hand_5 EF hand 2.8E-04 49 73
PF13202 EF-hand_5 EF hand 1.0E-05 86 110
PF13202 EF-hand_5 EF hand 8.3E-05 124 146
PF14658 EF-hand_9 EF-hand domain 2.3E-09 16 75
PF08726 EFhand_Ca_insen Ca2+ insensitive EF hand 2.4E-05 79 148

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7674.t1
MADSLTEEQVSEYKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR
KMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVQLMMQK*
Coding >Pro_DTO377G3_2|g7674.t1
ATGGCTGATTCCCTCACCGAAGAGCAAGTGTCTGAGTACAAGGAGGCCTTCTCCCTGTTTGACAAGGATGGCGAT
GGACAAATCACCACCAAGGAGCTTGGCACCGTCATGCGCTCGCTGGGCCAGAACCCCTCCGAGTCTGAGTTGCAG
GATATGATCAACGAGGTTGACGCCGACAACAACGGCACTATTGACTTCCCCGAATTCCTCACTATGATGGCTCGT
AAGATGAAGGACACCGATTCCGAGGAGGAGATTCGCGAGGCATTCAAGGTCTTCGATCGTGATAACAACGGGTTC
ATTTCCGCTGCTGAGCTTCGCCACGTCATGACCTCCATCGGCGAGAAGCTGACTGACGACGAGGTGGACGAGATG
ATCCGCGAGGCGGACCAGGATGGTGATGGCCGAATCGACTACAACGAGTTCGTTCAGCTCATGATGCAAAAATAA
Transcript >Pro_DTO377G3_2|g7674.t1
ATGGCTGATTCCCTCACCGAAGAGCAAGTGTCTGAGTACAAGGAGGCCTTCTCCCTGTTTGACAAGGATGGCGAT
GGACAAATCACCACCAAGGAGCTTGGCACCGTCATGCGCTCGCTGGGCCAGAACCCCTCCGAGTCTGAGTTGCAG
GATATGATCAACGAGGTTGACGCCGACAACAACGGCACTATTGACTTCCCCGAATTCCTCACTATGATGGCTCGT
AAGATGAAGGACACCGATTCCGAGGAGGAGATTCGCGAGGCATTCAAGGTCTTCGATCGTGATAACAACGGGTTC
ATTTCCGCTGCTGAGCTTCGCCACGTCATGACCTCCATCGGCGAGAAGCTGACTGACGACGAGGTGGACGAGATG
ATCCGCGAGGCGGACCAGGATGGTGATGGCCGAATCGACTACAACGAGTTCGTTCAGCTCATGATGCAAAAATAA
Gene >Pro_DTO377G3_2|g7674.t1
ATGGTATGTCCCTGATCCCCTAACTTCTCAGTTGTGTTGTCGAAAATTCAACCCCCACATTGCGGGGCATTTCAT
TTGAACTTCACTGACCATCGCATTCTCCAGGCTGATTCCCTCACCGAAGAGCAAGTGTCTGAGTACAAGGAGGCC
TTCTCCCTGTTTGTGAGTGACTCAACATACAGATTGAAGACTTGATAGTCGAAAATATGCTGACCGGAGTTGGTT
TGATTGCGAAATAGGACAAGGATGGCGATGGTACGTGTGGTCGCGCCCGACAGCTCAGTGTCCTCTGCGATCGAA
TTTCACGAGAAAAGTATTCTAACATACAATCCTACTAATAGGACAAATCACCACCAAGGAGCTTGGCACCGTCAT
GCGCTCGCTGGGCCAGAACCCCTCCGAGTCTGAGTTGCAGGATATGATCAACGAGGTTGACGCCGACAACAACGG
CACTATTGACTTCCCCGGTATTTGACCATAACCTCCTGGTATAAACGAGAGACGGCTACTGACGTGCGGTAGAAT
TCCTCACTATGATGGCTCGTAAGATGAAGGACACCGATTCCGAGGAGGAGATTCGCGAGGCATTCAAGGTCTTCG
ATCGTGATAACAACGGGTTCATTTCCGCTGCTGAGCTTCGCCACGTCATGACCTCCATCGGCGAGAAGCTGACTG
ACGACGAGGTGGACGAGATGATCCGCGAGGCGGACCAGGATGGTGATGGCCGAATCGACTGTATGTTTGGAAACA
ATCTTGGAGCCTACCGGCACTTGCCTGCCCAAATGCTAACCTCTCCCTCTCCATACAGACAACGAGTTCGTTCAG
CTCATGATGCAAAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail