Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7670.t1
Gene name
Locationscaffold_25:80303..81812
Strand+
Gene length (bp)1509
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03234 CDC37_N Cdc37 N terminal kinase binding 2.1E-49 2 135
PF08565 CDC37_M Cdc37 Hsp90 binding domain 1.1E-41 246 353
PF08564 CDC37_C Cdc37 C terminal domain 1.9E-33 380 470

GO

GO Term Description Terminal node
GO:0019901 protein kinase binding Yes
GO:0019900 kinase binding No
GO:0005515 protein binding No
GO:0005488 binding No
GO:0019899 enzyme binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7670.t1
MVLDYSKWDALELSDDSDVEVHPNVDKRSFIRAKQAQIHQQREQRRHEIKTLKYERIINDGLLSRIDKLLESLKK
HEDSSASPDEFIFTTIMEFASNPAEDQAPTPPEGVYTHEPEQPKFSQMMSSLVDQVKKEIGDSKPDNLFKAYIQG
VNGHLEKIQGLQKELFAKLAQLEKEEGAKITSDQLHEGFNQSHVAKADEKKKAAAKPKESSVELLNPGAGSSAAK
ADDEGDDDDPADIEISPLAKKFAQLKPGDYKACLQFISANPEIVAEKETDGLLVEAFNSQLKGQDAYARQCVHQG
LLLQYCRSLGRDGIQLFFTRITTKDHRASTLFLNDVNDTYARIKSRSAELSKDGSASNDPAGVEQIQLHAVDPNT
KITINIPAANSEDPTEIEVRKIFDAFPEDLQKALATESLDEVNKVLGKMSVEEAEVVVEQLGNGGMLSLEEGIVD
ATTAEGQKKLKELEEEGKQEVGEPGGDITELD*
Coding >Pro_DTO377G3_2|g7670.t1
ATGGTTCTTGATTATAGCAAATGGGACGCCTTGGAGCTGTCAGATGATTCGGATGTCGAAGTTCATCCCAATGTC
GATAAACGTTCTTTCATCCGAGCAAAGCAGGCCCAGATTCACCAGCAACGAGAGCAACGTCGCCATGAAATCAAA
ACCCTGAAGTACGAGCGCATTATCAATGATGGATTGCTGTCACGCATCGATAAGCTTCTTGAGTCTCTCAAGAAG
CATGAGGACTCGTCTGCTTCCCCTGATGAGTTCATTTTCACAACAATTATGGAGTTCGCAAGCAACCCCGCCGAA
GACCAGGCCCCCACCCCGCCGGAGGGAGTATACACACACGAACCGGAACAGCCCAAATTTTCCCAGATGATGAGC
TCACTGGTGGATCAGGTGAAGAAGGAAATTGGTGATTCTAAGCCTGACAATCTCTTCAAGGCATACATTCAGGGT
GTGAATGGACACTTAGAAAAGATTCAAGGACTCCAAAAGGAATTGTTTGCAAAGCTTGCGCAACTTGAGAAGGAG
GAAGGCGCTAAGATCACCAGTGATCAGCTACACGAAGGTTTCAACCAATCACATGTGGCCAAGGCTGATGAAAAG
AAGAAGGCGGCTGCCAAACCAAAGGAGAGCTCTGTTGAGCTCCTGAACCCTGGTGCGGGAAGCTCCGCCGCCAAG
GCTGACGATGAAGGCGACGATGATGATCCTGCCGATATCGAGATTAGTCCGCTTGCAAAGAAGTTCGCTCAGCTC
AAGCCTGGAGACTACAAGGCCTGTCTTCAGTTCATCTCAGCGAACCCCGAAATTGTCGCCGAGAAAGAGACCGAC
GGACTACTTGTTGAGGCATTCAACAGTCAGCTCAAGGGTCAAGACGCCTATGCTCGCCAGTGCGTGCACCAAGGT
CTACTTCTGCAATACTGCCGCTCGCTCGGTCGTGACGGCATCCAGCTGTTCTTCACTCGCATCACCACCAAGGAT
CACCGCGCATCCACCCTATTCCTTAATGATGTCAATGATACTTACGCTCGTATCAAATCCCGCTCCGCTGAACTC
AGCAAGGATGGCTCAGCATCCAACGATCCTGCGGGCGTAGAGCAAATCCAGCTGCACGCTGTTGACCCCAACACC
AAGATCACTATCAACATTCCTGCCGCTAATAGCGAAGATCCAACTGAGATTGAGGTACGCAAGATCTTCGACGCT
TTCCCTGAAGACCTGCAAAAGGCACTGGCAACCGAGTCCTTGGACGAAGTCAACAAGGTTCTCGGCAAGATGTCT
GTCGAGGAGGCAGAGGTCGTTGTGGAGCAATTGGGCAATGGCGGCATGCTCAGCTTGGAGGAAGGAATCGTCGAC
GCCACGACAGCAGAGGGCCAGAAGAAACTGAAGGAGTTGGAAGAAGAGGGAAAGCAGGAAGTTGGTGAGCCCGGT
GGTGATATTACCGAGCTTGACTAA
Transcript >Pro_DTO377G3_2|g7670.t1
ATGGTTCTTGATTATAGCAAATGGGACGCCTTGGAGCTGTCAGATGATTCGGATGTCGAAGTTCATCCCAATGTC
GATAAACGTTCTTTCATCCGAGCAAAGCAGGCCCAGATTCACCAGCAACGAGAGCAACGTCGCCATGAAATCAAA
ACCCTGAAGTACGAGCGCATTATCAATGATGGATTGCTGTCACGCATCGATAAGCTTCTTGAGTCTCTCAAGAAG
CATGAGGACTCGTCTGCTTCCCCTGATGAGTTCATTTTCACAACAATTATGGAGTTCGCAAGCAACCCCGCCGAA
GACCAGGCCCCCACCCCGCCGGAGGGAGTATACACACACGAACCGGAACAGCCCAAATTTTCCCAGATGATGAGC
TCACTGGTGGATCAGGTGAAGAAGGAAATTGGTGATTCTAAGCCTGACAATCTCTTCAAGGCATACATTCAGGGT
GTGAATGGACACTTAGAAAAGATTCAAGGACTCCAAAAGGAATTGTTTGCAAAGCTTGCGCAACTTGAGAAGGAG
GAAGGCGCTAAGATCACCAGTGATCAGCTACACGAAGGTTTCAACCAATCACATGTGGCCAAGGCTGATGAAAAG
AAGAAGGCGGCTGCCAAACCAAAGGAGAGCTCTGTTGAGCTCCTGAACCCTGGTGCGGGAAGCTCCGCCGCCAAG
GCTGACGATGAAGGCGACGATGATGATCCTGCCGATATCGAGATTAGTCCGCTTGCAAAGAAGTTCGCTCAGCTC
AAGCCTGGAGACTACAAGGCCTGTCTTCAGTTCATCTCAGCGAACCCCGAAATTGTCGCCGAGAAAGAGACCGAC
GGACTACTTGTTGAGGCATTCAACAGTCAGCTCAAGGGTCAAGACGCCTATGCTCGCCAGTGCGTGCACCAAGGT
CTACTTCTGCAATACTGCCGCTCGCTCGGTCGTGACGGCATCCAGCTGTTCTTCACTCGCATCACCACCAAGGAT
CACCGCGCATCCACCCTATTCCTTAATGATGTCAATGATACTTACGCTCGTATCAAATCCCGCTCCGCTGAACTC
AGCAAGGATGGCTCAGCATCCAACGATCCTGCGGGCGTAGAGCAAATCCAGCTGCACGCTGTTGACCCCAACACC
AAGATCACTATCAACATTCCTGCCGCTAATAGCGAAGATCCAACTGAGATTGAGGTACGCAAGATCTTCGACGCT
TTCCCTGAAGACCTGCAAAAGGCACTGGCAACCGAGTCCTTGGACGAAGTCAACAAGGTTCTCGGCAAGATGTCT
GTCGAGGAGGCAGAGGTCGTTGTGGAGCAATTGGGCAATGGCGGCATGCTCAGCTTGGAGGAAGGAATCGTCGAC
GCCACGACAGCAGAGGGCCAGAAGAAACTGAAGGAGTTGGAAGAAGAGGGAAAGCAGGAAGTTGGTGAGCCCGGT
GGTGATATTACCGAGCTTGACTAA
Gene >Pro_DTO377G3_2|g7670.t1
ATGGTTCTTGATTATAGCAAATGGGACGCCTTGGAGCTGTCAGATGATTCGGATGTCGAAGTTCATCCCAATGTC
GATAAACGTTCTTTCATCCGAGCAAAGCAGGCCCAGATTCACCAGCAACGAGAGCAACGTCGCCATGAAATCAAA
ACCCTGAAGTACGAGCGCATTATCAATGATGGATTGCTGTCACGCATCGATAAGCTTCTTGAGTCTCTCAAGAAG
CATGAGGACTCGTCTGCTTCCCCTGATGAGTTCATTTTCACAACAATTATGGAGTTCGCAAGCAACCCCGCCGAA
GACCAGGCCCCCACCCCGCCGGAGGGAGTATACACACACGAACCGGAACAGCCCAAATTTTCCCAGATGATGAGC
TCACTGGTGGATCAGGTGAAGAAGGAAATTGGTGATTCTAAGCCTGACAATCTCTTCAAGGCATACATTCAGGGT
GTGAATGGACACTTAGAAAAGATTCAAGGACTCCAAAAGGAATTGTTTGCAAAGCTTGCGCAACTTGAGAAGGAG
GAAGGCGCTAAGATCACCAGTGATCAGCTACACGAAGGTTTCAACCAATCACATGTGGCCAAGGCTGATGAAAAG
AAGAAGGCGGCTGCCAAACCAAAGGAGAGCTCTGTTGAGCTCCTGAACCCTGGTGCGGGAAGCTCCGCCGCCAAG
GCTGACGATGAAGGCGACGATGATGATCCTGCCGATATCGAGATTAGTCCGCTTGCAAAGAAGTTCGCTCAGCTC
AAGCCTGGAGACTACAAGGCCTGTCTTCAGTTCATCTCAGCGAACCCCGAAATTGTCGCCGAGAAAGAGACCGAC
GGACTACTTGTTGAGGCATTCAACAGTCAGCTCAAGGGTCAAGACGCCTATGCTCGCCAGTGCGTGCACCAAGGT
CTACTTCTGCAATACTGCCGCTCGCTCGGTCGTGACGGCATCCAGCTGTTCTTCACTCGGTATATCAACCTCCTA
GCTATTTTTTTTTCCCGGTCAATGGCTAACATATGAACTTCTAGCATCACCACCAAGGATCACCGCGCATCCACC
CTATTCCTTAATGATGTCAATGATACTTACGCTCGTATCAAATCCCGCTCCGCTGAACTCAGCAAGGATGGCTCA
GCATCCAACGATCCTGCGGGCGTAGAGCAAATCCAGCTGCACGCTGTTGACCCCAACACCAAGATCACTATCAAC
ATTCCTGCCGCTAATAGCGAAGATCCAACTGAGATTGAGGTACGCAAGATCTTCGACGCTTTCCCTGAAGACCTG
CAAAAGGCACTGGCAACCGAGTCCTTGGACGAAGTCAACAAGGTTCTCGGCAAGATGTCTGTCGAGGAGGCAGAG
GTCGTTGTGGAGCAATTGGGCAATGGCGGCATGCTCAGCTTGGAGGAAGGAATCGTCGACGCCACGACAGCAGAG
GGCCAGAAGAAACTGAAGGAGTTGGAAGAAGAGGGAAAGCAGGAAGTTGGTGAGCCCGGTGGTGATATTACCGAG
CTTGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail