Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7668.t1
Gene name
Locationscaffold_25:75409..76862
Strand-
Gene length (bp)1453
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01733 Nucleoside_tran Nucleoside transporter 5.2E-42 148 448

GO

GO Term Description Terminal node
GO:0005337 nucleoside transmembrane transporter activity Yes
GO:1901642 nucleoside transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0009987 cellular process No
GO:0055085 transmembrane transport No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0071702 organic substance transport No
GO:1901264 carbohydrate derivative transport No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0015931 nucleobase-containing compound transport No
GO:0005215 transporter activity No
GO:0015858 nucleoside transport No
GO:0110165 cellular anatomical entity No
GO:0071705 nitrogen compound transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 80 102 22
3 114 136 22
4 146 168 22
5 181 203 22
6 228 250 22
7 289 311 22
8 360 379 19
9 391 413 22
10 428 450 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7668.t1
MNRIRSLIARPAAYERLQDSAADDADETTYTQRQQQSPFSRVHYGIFFLLGVSMLWAWNMFLAAAPYFYSRFQSD
DWTRLHYQPSIQSMSTVTNLGAAFTLAKLQKNASYPQRITFSLLLNSVVFAILAFSAVVMTDSSPRAYFGFLMVM
VCAASLATGINQNGVFAYVSGFGRDEYTQAIMSGQGVAGVLPCIVQIFSVLAVPPKEDSGRDQEQDPSMPQTSAS
TSAFIYFLTSTGVSAIALLAFLYLLRQQPSSRQKLTRDDDESITDDRENSKTVSLWTLFVKLRFLAFAVFVCFLV
SMVFPVYTAEIRSVNDPASSRIYDPSVFVPLAFLLWNLGDLTGRMCVAIPGVSLGQHPQVAAMVAIGRVIFIPMY
QLCNINGQGAAVKSDIFYFLIQFFFGATNGYLGTSCMMGASHWVVADERPAAGGFMSMVLVGGLAAGSLLSFSVA
SG*
Coding >Pro_DTO377G3_2|g7668.t1
ATGAACCGCATACGTAGTCTCATCGCCCGCCCAGCGGCATATGAGCGACTACAGGACTCCGCCGCAGACGACGCC
GATGAGACAACATACACGCAGCGACAGCAGCAATCTCCCTTTTCAAGAGTACATTATGGCATATTCTTCCTCCTC
GGGGTGTCTATGCTGTGGGCGTGGAACATGTTCCTTGCCGCTGCACCATATTTCTACAGCCGGTTTCAGTCGGAC
GACTGGACAAGGCTACACTATCAACCGTCGATTCAGTCCATGTCAACCGTCACCAACCTCGGAGCCGCCTTTACC
CTAGCAAAGCTACAGAAGAACGCGTCCTATCCACAGCGGATAACGTTTTCGCTGTTGCTGAACTCTGTGGTCTTC
GCTATTTTGGCCTTTTCGGCAGTTGTCATGACCGATTCCTCGCCGCGAGCGTACTTTGGTTTCCTGATGGTGATG
GTGTGCGCCGCGAGTCTAGCCACTGGTATCAACCAGAATGGCGTATTTGCGTATGTCTCCGGGTTTGGGAGGGAT
GAATATACCCAGGCTATCATGAGTGGACAGGGTGTTGCTGGTGTGCTGCCTTGCATTGTTCAGATCTTCTCTGTG
TTGGCTGTGCCCCCGAAGGAGGATAGCGGCCGAGACCAAGAGCAAGACCCCAGCATGCCTCAGACGAGTGCGTCG
ACGTCGGCGTTTATTTATTTCCTTACGTCTACGGGTGTCTCGGCCATTGCTTTGCTGGCCTTCCTCTATCTTTTG
AGGCAACAACCTTCTTCAAGACAAAAGTTGACAAGAGATGACGATGAGTCTATTACGGATGACCGTGAAAATTCC
AAGACTGTCAGCCTCTGGACTTTGTTCGTCAAGCTACGGTTTCTGGCGTTTGCTGTTTTCGTCTGCTTTCTGGTC
TCCATGGTATTCCCAGTTTACACGGCGGAAATCAGGTCAGTCAACGATCCTGCTAGTTCACGGATCTACGATCCT
AGTGTCTTTGTTCCCTTGGCATTTTTGCTCTGGAACCTAGGCGACTTGACCGGGAGAATGTGTGTGGCTATTCCA
GGAGTGTCATTGGGACAACATCCTCAGGTGGCTGCCATGGTGGCCATTGGGCGTGTCATTTTCATTCCCATGTAC
CAGCTCTGCAACATCAACGGCCAAGGCGCTGCCGTTAAGAGTGACATTTTCTATTTCCTTATACAGTTCTTCTTT
GGTGCAACAAATGGGTACCTGGGCACAAGCTGTATGATGGGCGCTAGTCACTGGGTTGTTGCCGATGAAAGGCCG
GCTGCTGGTGGATTTATGAGCATGGTTCTCGTCGGTGGATTGGCTGCTGGAAGCTTGTTGAGTTTCTCTGTCGCC
AGTGGTTGA
Transcript >Pro_DTO377G3_2|g7668.t1
ATGAACCGCATACGTAGTCTCATCGCCCGCCCAGCGGCATATGAGCGACTACAGGACTCCGCCGCAGACGACGCC
GATGAGACAACATACACGCAGCGACAGCAGCAATCTCCCTTTTCAAGAGTACATTATGGCATATTCTTCCTCCTC
GGGGTGTCTATGCTGTGGGCGTGGAACATGTTCCTTGCCGCTGCACCATATTTCTACAGCCGGTTTCAGTCGGAC
GACTGGACAAGGCTACACTATCAACCGTCGATTCAGTCCATGTCAACCGTCACCAACCTCGGAGCCGCCTTTACC
CTAGCAAAGCTACAGAAGAACGCGTCCTATCCACAGCGGATAACGTTTTCGCTGTTGCTGAACTCTGTGGTCTTC
GCTATTTTGGCCTTTTCGGCAGTTGTCATGACCGATTCCTCGCCGCGAGCGTACTTTGGTTTCCTGATGGTGATG
GTGTGCGCCGCGAGTCTAGCCACTGGTATCAACCAGAATGGCGTATTTGCGTATGTCTCCGGGTTTGGGAGGGAT
GAATATACCCAGGCTATCATGAGTGGACAGGGTGTTGCTGGTGTGCTGCCTTGCATTGTTCAGATCTTCTCTGTG
TTGGCTGTGCCCCCGAAGGAGGATAGCGGCCGAGACCAAGAGCAAGACCCCAGCATGCCTCAGACGAGTGCGTCG
ACGTCGGCGTTTATTTATTTCCTTACGTCTACGGGTGTCTCGGCCATTGCTTTGCTGGCCTTCCTCTATCTTTTG
AGGCAACAACCTTCTTCAAGACAAAAGTTGACAAGAGATGACGATGAGTCTATTACGGATGACCGTGAAAATTCC
AAGACTGTCAGCCTCTGGACTTTGTTCGTCAAGCTACGGTTTCTGGCGTTTGCTGTTTTCGTCTGCTTTCTGGTC
TCCATGGTATTCCCAGTTTACACGGCGGAAATCAGGTCAGTCAACGATCCTGCTAGTTCACGGATCTACGATCCT
AGTGTCTTTGTTCCCTTGGCATTTTTGCTCTGGAACCTAGGCGACTTGACCGGGAGAATGTGTGTGGCTATTCCA
GGAGTGTCATTGGGACAACATCCTCAGGTGGCTGCCATGGTGGCCATTGGGCGTGTCATTTTCATTCCCATGTAC
CAGCTCTGCAACATCAACGGCCAAGGCGCTGCCGTTAAGAGTGACATTTTCTATTTCCTTATACAGTTCTTCTTT
GGTGCAACAAATGGGTACCTGGGCACAAGCTGTATGATGGGCGCTAGTCACTGGGTTGTTGCCGATGAAAGGCCG
GCTGCTGGTGGATTTATGAGCATGGTTCTCGTCGGTGGATTGGCTGCTGGAAGCTTGTTGAGTTTCTCTGTCGCC
AGTGGTTGA
Gene >Pro_DTO377G3_2|g7668.t1
ATGAACCGCATACGTAGTCTCATCGCCCGCCCAGCGGCATATGAGCGACTACAGGACTCCGCCGCAGACGACGCC
GATGAGACAACATACACGCAGCGACAGCAGCAATCTCCCTTTTCAAGAGTACATTATGGCATATTCTTCCTCCTC
GGGGTGTCTATGCTGTGGGCGTGGTAAGCGGAACTTAACAGTCTCCGAACCCGGAGGAAACAAGCCACATACATG
TGTGTTGGGCCGACCATGAAGCTAACGCAGAGCATGATCTAGGAACATGTTCCTTGCCGCTGCACCATATTTCTA
CAGCCGGTTTCAGTCGGACGACTGGACAAGGCTACACTATCAACCGTCGATTCAGTCCATGTCAACCGTCACCAA
CCTCGGAGCCGCCTTTACCCTAGCAAAGCTACAGAAGAACGCGTCCTATCCACAGCGGATAACGTTTTCGCTGTT
GCTGAACTCTGTGGTCTTCGCTATTTTGGCCTTTTCGGCAGTTGTCATGACCGATTCCTCGCCGCGAGCGTACTT
TGGTTTCCTGATGGTGATGGTGTGCGCCGCGAGTCTAGCCACTGGTATCAACCAGAATGGCGTATTTGCGTATGT
CTCCGGGTTTGGGAGGGATGAATATACCCAGGCTATCATGAGTGGACAGGGTGTTGCTGGTGTGCTGCCTTGCAT
TGTTCAGATCTTCTCTGTGTTGGCTGTGCCCCCGAAGGAGGATAGCGGCCGAGACCAAGAGCAAGACCCCAGCAT
GCCTCAGACGAGTGCGTCGACGTCGGCGTTTATTTATTTCCTTACGTCTACGGGTGTCTCGGCCATTGCTTTGCT
GGCCTTCCTCTATCTTTTGAGGCAACAACCTTCTTCAAGACAAAAGTTGACAAGAGATGACGATGAGTCTATTAC
GGATGACCGTGAAAATTCCAAGACTGTCAGCCTCTGGACTTTGTTCGTCAAGCTACGGTTTCTGGCGTTTGCTGT
TTTCGTCTGCTTTCTGGTCTCCATGGTATTCCCAGTTTACACGGCGGAAATCAGGTCAGTCAACGATCCTGCTAG
TTCACGGATCTACGATCCTAGTGTCTTTGTTCCCTTGGCATTTTTGCTCTGGAACCTAGGCGACTTGACCGGGAG
AATGTGTGTGGCTATTCCAGGAGTGTCATTGGGACAACATCCTCAGGTGGCTGCCATGGTGGCCATTGGGCGTGT
CATTTTCATTCCCATGTACCAGCTCTGCAACATCAACGGCCAAGGCGCTGCCGTTAAGAGTGACATTTTCTATTT
CCTTATACAGTTCTTCTTTGGTGCAACAAATGGGTACCTGGGCACAAGCTGTATGATGGGCGCTAGTCACTGGGT
TGTTGCCGATGAAAGGCCGGCTGCTGGTGGATTTATGAGCATGGTTCTCGTCGGTGGATTGGCTGCTGGAAGCTT
GTTGAGTTTCTCTGTCGCCAGTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail