Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7661.t1
Gene name
Locationscaffold_25:60829..61476
Strand-
Gene length (bp)647
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 9.7E-23 4 116

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 56.44 25.08 87.80
5d_25C Five days - 25 degrees Celsius 66.40 30.56 102.24
7d_25C Seven days - 25 degrees Celsius 74.87 35.08 114.65
10d_25C Ten days - 25 degrees Celsius 110.00 57.82 162.19
7d_15C Seven days - 15 degrees Celsius 70.83 32.88 108.79
7d_30C Seven days - 30 degrees Celsius 61.10 27.17 95.04

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.679238 no
3d_25C 7d_25C 0.420149 no
3d_25C 7d_15C 0.538626 no
3d_25C 7d_30C 0.862772 no
3d_25C 10d_25C 0.017485 yes
5d_25C 7d_25C 0.769817 no
5d_25C 7d_15C 0.887343 no
5d_25C 7d_30C 0.851935 no
5d_25C 10d_25C 0.066960 no
7d_25C 7d_15C 0.906483 no
7d_25C 7d_30C 0.590963 no
7d_25C 10d_25C 0.194439 no
7d_15C 7d_30C 0.712434 no
7d_15C 10d_25C 0.125826 no
7d_30C 10d_25C 0.035014 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7661.t1
MDPKVGVGVFVLNAAGKFLIGKRKGSLGAGTWGLPGGHLDFGESFETCAVRETLEETGLKIQDVRFLTATNSILK
AENKHYITIFMGAVCEDGAEPQVIEPDRCEGWEWISWDELRAYGEEQIKAGDGFEGRRFFSPLLGLFEQRPDFRV
*
Coding >Pro_DTO377G3_2|g7661.t1
ATGGACCCCAAAGTCGGAGTCGGCGTTTTTGTTCTCAATGCTGCAGGCAAATTCCTGATCGGTAAGCGAAAGGGG
AGCCTTGGCGCTGGCACATGGGGACTACCAGGTGGACACCTTGATTTTGGTGAATCTTTTGAGACTTGCGCGGTC
CGTGAGACTCTCGAAGAAACAGGTCTGAAGATTCAGGATGTGCGGTTCCTGACGGCCACGAATTCAATCTTGAAA
GCGGAGAATAAGCACTACATTACCATTTTCATGGGTGCTGTCTGTGAGGATGGTGCTGAACCCCAGGTAATTGAG
CCGGATAGGTGCGAGGGGTGGGAATGGATCTCGTGGGATGAATTGCGGGCGTATGGGGAGGAGCAAATCAAGGCT
GGTGACGGGTTCGAGGGAAGAAGGTTCTTTTCGCCTCTTTTGGGATTATTTGAACAACGTCCGGATTTTCGAGTT
TGA
Transcript >Pro_DTO377G3_2|g7661.t1
ATGGACCCCAAAGTCGGAGTCGGCGTTTTTGTTCTCAATGCTGCAGGCAAATTCCTGATCGGTAAGCGAAAGGGG
AGCCTTGGCGCTGGCACATGGGGACTACCAGGTGGACACCTTGATTTTGGTGAATCTTTTGAGACTTGCGCGGTC
CGTGAGACTCTCGAAGAAACAGGTCTGAAGATTCAGGATGTGCGGTTCCTGACGGCCACGAATTCAATCTTGAAA
GCGGAGAATAAGCACTACATTACCATTTTCATGGGTGCTGTCTGTGAGGATGGTGCTGAACCCCAGGTAATTGAG
CCGGATAGGTGCGAGGGGTGGGAATGGATCTCGTGGGATGAATTGCGGGCGTATGGGGAGGAGCAAATCAAGGCT
GGTGACGGGTTCGAGGGAAGAAGGTTCTTTTCGCCTCTTTTGGGATTATTTGAACAACGTCCGGATTTTCGAGTT
TGA
Gene >Pro_DTO377G3_2|g7661.t1
ATGGACCCCAAAGTCGGAGTCGGCGTTTTTGTTCTCAATGCTGCAGGCAAATTCCTGATCGGTAAGCGAAAGGGG
AGCCTTGGCGCTGGTACGTGCATCCAATAGAATACTATACATGCAATAGACCTCAATTATAATCAAAGCTAACCA
TTTGTGATTAAAGGCACATGGGGACTACCAGGTGGACACCTTGATTTTGGTGAATCTTTTGAGACTTGCGCGGTC
CGTGAGACTCTCGAAGAAACAGGTCTGAAGATTCAGGATGTGCGGTTCCTGACGGCCACGAATTCAATCTTGAAA
GCGGAGAATAAGCACTACATTACCATTTTCATGGGTGCTGTCTGTGAGGATGGTGCTGAACCCCAGGTAGGTTGA
TTGAGGTTTGTTTTATGTGTTTATGTGTTTTTCTGTTTTTATATACCCCCGTCTCGTGGCTGCGTACACTGCAGG
AACAGAACCAGGATACGCGGCTTACTTCTTGGTAGGTAATTGAGCCGGATAGGTGCGAGGGGTGGGAATGGATCT
CGTGGGATGAATTGCGGGCGTATGGGGAGGAGCAAATCAAGGCTGGTGACGGGTTCGAGGGAAGAAGGTTCTTTT
CGCCTCTTTTGGGATTATTTGAACAACGTCCGGATTTTCGAGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail