Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g766.t1
Gene name
Locationscaffold_01:2047776..2048550
Strand-
Gene length (bp)774
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 4.2E-15 37 97

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 90.91 50.96 130.86
5d_25C Five days - 25 degrees Celsius 84.48 46.29 122.68
7d_25C Seven days - 25 degrees Celsius 69.11 36.20 102.02
10d_25C Ten days - 25 degrees Celsius 52.64 25.82 79.46
7d_15C Seven days - 15 degrees Celsius 74.22 39.70 108.74
7d_30C Seven days - 30 degrees Celsius 74.31 39.72 108.90

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.836593 no
3d_25C 7d_25C 0.317643 no
3d_25C 7d_15C 0.488815 no
3d_25C 7d_30C 0.491415 no
3d_25C 10d_25C 0.028642 yes
5d_25C 7d_25C 0.509457 no
5d_25C 7d_15C 0.700122 no
5d_25C 7d_30C 0.698377 no
5d_25C 10d_25C 0.065461 no
7d_25C 7d_15C 0.853545 no
7d_25C 7d_30C 0.846734 no
7d_25C 10d_25C 0.362091 no
7d_15C 7d_30C 0.997560 no
7d_15C 10d_25C 0.217304 no
7d_30C 10d_25C 0.212585 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g766.t1
MSDDEPDQEFLEALEKEASEFKKDVEIDRIRSAFKLDSYAVLDLQPGVTEKDIKVQYRKISLLIHPDKTKNPAAP
DAFDRLNKAQEALLDEKQREYLDECISDARRLLIREHKYTLDSPELKTEEFKVEWRKKTISVLLDEEARRRRQLK
ARLQEEGREQRKEEEELEARKRKRENDKKWEETREERIGSWRDFQKGRKPGGDEKKKKKKMKVLG*
Coding >Pro_DTO377G3_2|g766.t1
ATGTCGGACGACGAGCCAGACCAGGAATTTCTCGAAGCTCTAGAGAAAGAGGCCTCCGAGTTTAAAAAGGATGTT
GAGATCGATCGCATTCGCTCGGCATTCAAGCTCGATTCCTACGCCGTCCTGGACCTCCAACCCGGTGTTACAGAA
AAAGACATCAAAGTCCAATACCGCAAGATCTCCCTCCTGATCCACCCCGACAAGACCAAGAACCCCGCTGCTCCA
GATGCCTTCGATCGCCTCAATAAGGCACAGGAAGCTCTTCTAGACGAGAAGCAACGCGAATACCTGGACGAATGT
ATCTCCGATGCGCGCCGCCTGTTGATTCGTGAACACAAGTACACACTCGACTCCCCCGAGCTTAAAACCGAGGAG
TTCAAGGTTGAGTGGCGGAAGAAGACAATCAGCGTGCTATTGGATGAAGAAGCGCGACGCCGGCGACAGCTCAAG
GCACGTTTGCAGGAGGAAGGTCGTGAGCAACGCAAGGAAGAAGAAGAGCTCGAGGCACGCAAGCGCAAGCGCGAA
AATGACAAGAAGTGGGAGGAGACGCGCGAAGAGCGCATTGGTAGCTGGCGGGATTTCCAGAAGGGGCGCAAACCT
GGTGGTGATGAGAAGAAGAAGAAGAAGAAGATGAAGGTGTTGGGCTGA
Transcript >Pro_DTO377G3_2|g766.t1
ATGTCGGACGACGAGCCAGACCAGGAATTTCTCGAAGCTCTAGAGAAAGAGGCCTCCGAGTTTAAAAAGGATGTT
GAGATCGATCGCATTCGCTCGGCATTCAAGCTCGATTCCTACGCCGTCCTGGACCTCCAACCCGGTGTTACAGAA
AAAGACATCAAAGTCCAATACCGCAAGATCTCCCTCCTGATCCACCCCGACAAGACCAAGAACCCCGCTGCTCCA
GATGCCTTCGATCGCCTCAATAAGGCACAGGAAGCTCTTCTAGACGAGAAGCAACGCGAATACCTGGACGAATGT
ATCTCCGATGCGCGCCGCCTGTTGATTCGTGAACACAAGTACACACTCGACTCCCCCGAGCTTAAAACCGAGGAG
TTCAAGGTTGAGTGGCGGAAGAAGACAATCAGCGTGCTATTGGATGAAGAAGCGCGACGCCGGCGACAGCTCAAG
GCACGTTTGCAGGAGGAAGGTCGTGAGCAACGCAAGGAAGAAGAAGAGCTCGAGGCACGCAAGCGCAAGCGCGAA
AATGACAAGAAGTGGGAGGAGACGCGCGAAGAGCGCATTGGTAGCTGGCGGGATTTCCAGAAGGGGCGCAAACCT
GGTGGTGATGAGAAGAAGAAGAAGAAGAAGATGAAGGTGTTGGGCTGA
Gene >Pro_DTO377G3_2|g766.t1
ATGTCGGACGACGAGCCAGACCAGGAATTTCTCGAAGCTCTAGAGAAAGAGGCCTCCGAGTTTAAAAAGGTATGC
CCTCCTCCACATGGTATACATCTAGATTGCGACTGACACGCGACACAGGATGTTGAGATCGATCGCATTCGCTCG
GCATTCAAGCTCGATTCGTACGTCTAATCTTAATATCTACAATAGAATAATGCCCCTCTATATATTTTACATACA
CTAACCCACTGCAGCTACGCCGTCCTGGACCTCCAACCCGGTGTTACAGAAAAAGACATCAAAGTCCAATACCGC
AAGATCTCCCTCCTGATCCACCCCGACAAGACCAAGAACCCCGCTGCTCCAGATGCCTTCGATCGCCTCAATAAG
GCACAGGAAGCTCTTCTAGACGAGAAGCAACGCGAATACCTGGACGAATGTATCTCCGATGCGCGCCGCCTGTTG
ATTCGTGAACACAAGTACACACTCGACTCCCCCGAGCTTAAAACCGAGGAGTTCAAGGTTGAGTGGCGGAAGAAG
ACAATCAGCGTGCTATTGGATGAAGAAGCGCGACGCCGGCGACAGCTCAAGGCACGTTTGCAGGAGGAAGGTCGT
GAGCAACGCAAGGAAGAAGAAGAGCTCGAGGCACGCAAGCGCAAGCGCGAAAATGACAAGAAGTGGGAGGAGACG
CGCGAAGAGCGCATTGGTAGCTGGCGGGATTTCCAGAAGGGGCGCAAACCTGGTGGTGATGAGAAGAAGAAGAAG
AAGAAGATGAAGGTGTTGGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail