Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7659.t1
Gene name
Locationscaffold_25:57943..58698
Strand+
Gene length (bp)755
Transcript length (bp)699
Coding sequence length (bp)699
Protein length (aa) 233

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04525 LOR LURP-one-related 1.7E-05 35 223

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 207 229 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 87.38 49.81 124.95
5d_25C Five days - 25 degrees Celsius 67.25 36.50 98.01
7d_25C Seven days - 25 degrees Celsius 42.38 20.63 64.14
10d_25C Ten days - 25 degrees Celsius 32.98 14.79 51.17
7d_15C Seven days - 15 degrees Celsius 67.36 35.75 98.97
7d_30C Seven days - 30 degrees Celsius 60.01 31.77 88.24

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.330971 no
3d_25C 7d_25C 0.003197 yes
3d_25C 7d_15C 0.345319 no
3d_25C 7d_30C 0.147227 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.085662 no
5d_25C 7d_15C 0.996581 no
5d_25C 7d_30C 0.747272 no
5d_25C 10d_25C 0.008469 yes
7d_25C 7d_15C 0.087906 no
7d_25C 7d_30C 0.236902 no
7d_25C 10d_25C 0.481668 no
7d_15C 7d_30C 0.742467 no
7d_15C 10d_25C 0.009124 yes
7d_30C 10d_25C 0.035243 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7659.t1
MSYTSYSDARLSRSYSSKPRKPLRSPDRDIAFRNQYIARSKTTLVLRPFGSPQSAVAYKITEEDGTPQFTVTGRK
YTDRSCREFRDKSGLPLFELHRKLSWTNSWSISLPGCDTATIATGTPRWTLGNTSFGNFALSFENAAAFEGKRGD
EKMLTLNIERHGNALALFDVVDGDGKVAEIRESIRHNEKLALMRGSRQGYRPAMDVIIMPGVDISLVVTIAVIVS
DWVFGSS*
Coding >Pro_DTO377G3_2|g7659.t1
ATGTCCTACACCTCCTACTCTGACGCTCGACTATCGCGCTCATACTCCTCTAAGCCCCGCAAACCCCTTCGATCG
CCAGACCGCGATATCGCCTTCCGGAACCAATACATAGCGCGCTCAAAGACAACCCTCGTGCTCAGACCATTTGGC
AGCCCCCAATCCGCCGTCGCATATAAGATCACCGAAGAGGATGGAACACCACAGTTCACGGTGACTGGTCGCAAG
TACACCGATCGCTCGTGTCGGGAGTTTCGCGATAAATCGGGTCTGCCGCTCTTCGAGCTACACCGGAAATTGTCG
TGGACGAATAGTTGGTCGATTAGCTTGCCAGGCTGTGATACTGCGACGATAGCTACTGGCACTCCGCGATGGACG
TTGGGCAATACTTCGTTTGGGAATTTTGCTCTTTCGTTCGAAAATGCGGCTGCGTTTGAGGGAAAGCGCGGGGAT
GAGAAAATGCTTACTCTGAATATTGAACGGCATGGGAATGCGCTGGCGCTTTTTGATGTCGTTGATGGGGATGGG
AAGGTTGCTGAAATTCGGGAGAGTATTCGTCATAATGAGAAACTGGCTTTGATGAGAGGCTCTAGACAGGGGTAT
CGACCTGCTATGGATGTCATTATAATGCCTGGAGTAGATATTTCATTGGTTGTGACTATCGCTGTTATAGTATCT
GACTGGGTTTTTGGCTCGAGTTGA
Transcript >Pro_DTO377G3_2|g7659.t1
ATGTCCTACACCTCCTACTCTGACGCTCGACTATCGCGCTCATACTCCTCTAAGCCCCGCAAACCCCTTCGATCG
CCAGACCGCGATATCGCCTTCCGGAACCAATACATAGCGCGCTCAAAGACAACCCTCGTGCTCAGACCATTTGGC
AGCCCCCAATCCGCCGTCGCATATAAGATCACCGAAGAGGATGGAACACCACAGTTCACGGTGACTGGTCGCAAG
TACACCGATCGCTCGTGTCGGGAGTTTCGCGATAAATCGGGTCTGCCGCTCTTCGAGCTACACCGGAAATTGTCG
TGGACGAATAGTTGGTCGATTAGCTTGCCAGGCTGTGATACTGCGACGATAGCTACTGGCACTCCGCGATGGACG
TTGGGCAATACTTCGTTTGGGAATTTTGCTCTTTCGTTCGAAAATGCGGCTGCGTTTGAGGGAAAGCGCGGGGAT
GAGAAAATGCTTACTCTGAATATTGAACGGCATGGGAATGCGCTGGCGCTTTTTGATGTCGTTGATGGGGATGGG
AAGGTTGCTGAAATTCGGGAGAGTATTCGTCATAATGAGAAACTGGCTTTGATGAGAGGCTCTAGACAGGGGTAT
CGACCTGCTATGGATGTCATTATAATGCCTGGAGTAGATATTTCATTGGTTGTGACTATCGCTGTTATAGTATCT
GACTGGGTTTTTGGCTCGAGTTGA
Gene >Pro_DTO377G3_2|g7659.t1
ATGTCCTACACCTCCTACTCTGACGCTCGACTATCGCGCTCATACTCCTCTAAGCCCCGCAAACCCCTTCGATCG
CCAGACCGCGATATCGCCTTCCGGAACCAATACATAGCGCGCTCAAAGACAACCCTCGTGCTCAGACCATTTGGC
AGCCCCCAATCCGCCGTCGCATATAAGATCACCGAAGAGGATGGAACACCACAGTTCACGGTGACTGGTCGCAAG
TACACCGATCGCTCGTGTCGGGAGTTTCGCGATAAATCGGGTCTGCCGCTCTTCGAGCTACACCGGAAATTGTCG
TGGACGAATAGTTGGTCGATTAGCTTGCCAGGCTGTGATACTGCGACGATAGCTACTGGCACTCCGCGATGGACG
TTGGGCAATACTTCGTTTGGGAATTTTGCTCTTTCGTTCGAAAATGCGGCTGCGTTTGAGGGAAAGCGCGGGGAT
GAGAAAATGCTTACTCTGAATATTGAACGGCATGGGAATGCGCTGGCGCTTTTTGATGTCGTTGATGGGGATGGG
AAGGTTGCTGAAATTCGGGAGAGTATTCGTCATAATGAGAAACTGGCTTTGATGAGAGGCTCTAGACAGGGGTAT
CGACCTGCTATGGATGTCATTATAATGCCTGGAGTAGATATTTCATTGGTGCGTATTCGAATCTTCAGGGCTCTT
GGTGTATAGATTGACTGATATTTGTACAGGTTGTGACTATCGCTGTTATAGTATCTGACTGGGTTTTTGGCTCGA
GTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail