Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7652.t1
Gene name
Locationscaffold_25:44344..44954
Strand-
Gene length (bp)610
Transcript length (bp)225
Coding sequence length (bp)225
Protein length (aa) 75

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02238 COX7a Cytochrome c oxidase subunit VII 4.5E-22 17 69

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6643.68 4068.71 9218.64
5d_25C Five days - 25 degrees Celsius 5046.47 3076.63 7016.31
7d_25C Seven days - 25 degrees Celsius 3950.54 2434.82 5466.26
10d_25C Ten days - 25 degrees Celsius 3397.06 2091.81 4702.31
7d_15C Seven days - 15 degrees Celsius 4776.26 2950.73 6601.80
7d_30C Seven days - 30 degrees Celsius 3001.14 1844.03 4158.26

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.238276 no
3d_25C 7d_25C 0.007437 yes
3d_25C 7d_15C 0.140277 no
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.283806 no
5d_25C 7d_15C 0.859099 no
5d_25C 7d_30C 0.008807 yes
5d_25C 10d_25C 0.054411 no
7d_25C 7d_15C 0.441053 no
7d_25C 7d_30C 0.220560 no
7d_25C 10d_25C 0.550467 no
7d_15C 7d_30C 0.023923 yes
7d_15C 10d_25C 0.110044 no
7d_30C 10d_25C 0.648354 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7652.t1
MFRATSSRMAGFVFRENRVPYYQRLFQQHDGKRQWYKTSRSGYVMYPYLISVYGLGAATMYAMCRMVLGHKTWY*
Coding >Pro_DTO377G3_2|g7652.t1
ATGTTCCGTGCTACTAGCTCCCGCATGGCTGGCTTCGTGTTCCGTGAGAACCGTGTGCCCTACTACCAGCGTCTC
TTCCAGCAACACGATGGCAAGCGCCAATGGTACAAGACCTCCCGCTCCGGCTACGTCATGTACCCCTACCTCATC
TCTGTCTACGGCCTCGGTGCTGCTACCATGTACGCCATGTGCCGCATGGTTCTCGGCCACAAGACTTGGTACTAA
Transcript >Pro_DTO377G3_2|g7652.t1
ATGTTCCGTGCTACTAGCTCCCGCATGGCTGGCTTCGTGTTCCGTGAGAACCGTGTGCCCTACTACCAGCGTCTC
TTCCAGCAACACGATGGCAAGCGCCAATGGTACAAGACCTCCCGCTCCGGCTACGTCATGTACCCCTACCTCATC
TCTGTCTACGGCCTCGGTGCTGCTACCATGTACGCCATGTGCCGCATGGTTCTCGGCCACAAGACTTGGTACTAA
Gene >Pro_DTO377G3_2|g7652.t1
ATGTTCCGTGCTACTAGCTCCCGCATGGCTGGGTATGTACTCCCTTCGAATTGCCACAATAATCCCCCGCGCACA
AACCCGACTTTGAGAGTGCGCCCATCGAATTTCCTCCCACGATCTTCGGGGTCCAATTACGATTGACGCGGCTGC
GGGACCTGTCATCCCACCATTAATTACAATTTATACTGACTGGTTCTGCTTAGCTTCGTGTTCCGTGAGAACCGT
GTGCCCTACTACCAGCGTCTCTTCCAGCAACACGATGGCAAGCGCCAATGGTACAAGGTCAGTACCCGCCGGAAG
GGGCATATGCCCTCAATGAAGTTTCCGGAAGAACAAGAAACTGACATTGGAATTGTCTCGCAGACCTCCCGCTCC
GGCTACGTCATGTACCCCTACCTCATCTCTGTCTACGGCCTCGGTGCTGGTGAGTAGACCCGTCTTCCGATATGA
GATCCGGTCGAGGATAGAAACTAATCGTCAATAGCTACCATGTACGCCATGTGCCGCATGGTTCTCGTTAGTCCA
CCCATCCGCTACTTCTCATACTCTAACGAGAAGCACGAGCGTTCATATGCTAACTTCTTTACAGGGCCACAAGAC
TTGGTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail