Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g764.t1
Gene name
Locationscaffold_01:2043722..2045748
Strand+
Gene length (bp)2026
Transcript length (bp)1806
Coding sequence length (bp)1806
Protein length (aa) 602

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.4E-09 277 334
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.0E-08 365 425

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 1.09 0.12 2.07
5d_25C Five days - 25 degrees Celsius 1.77 0.37 3.16
7d_25C Seven days - 25 degrees Celsius 1.42 0.21 2.64
10d_25C Ten days - 25 degrees Celsius 1.04 0.12 1.95
7d_15C Seven days - 15 degrees Celsius 2.58 0.65 4.51
7d_30C Seven days - 30 degrees Celsius 3.51 0.86 6.17

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.354964 no
3d_25C 7d_25C 0.677768 no
3d_25C 7d_15C 0.057409 no
3d_25C 7d_30C 0.010411 yes
3d_25C 10d_25C 0.945148 no
5d_25C 7d_25C 0.729228 no
5d_25C 7d_15C 0.434910 no
5d_25C 7d_30C 0.123204 no
5d_25C 10d_25C 0.305203 no
7d_25C 7d_15C 0.203310 no
7d_25C 7d_30C 0.047696 yes
7d_25C 10d_25C 0.605611 no
7d_15C 7d_30C 0.539713 no
7d_15C 10d_25C 0.047323 yes
7d_30C 10d_25C 0.007437 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g764.t1
MHPQGSQHTSSSGSGSCQTSSSQSAQYPQEPRTPYGPRYHQSTNPSSIDSSGAGLTNLFRGLNLQNSRPKFNGSK
GTAPVQMNTNMDWSNTNRAYNSPFILVPNSTVFNGVPTVSSFVPNGVSGQTDQMGQFSYLPTGVYPNVNPVMAGG
YSSWPYMMNYDMQDGTTNKQAWVSEGQKGVQGENNGQINYYPSALVSGMDGSSMSGYSYGGMVPSQLGSLSLPLQ
MMKTPNGYVVQDLEALTQQDPAIPRAVPAMWTNPSELTLAKCLENREGITNVYIRGFLPETTDEMLHAYAARFGK
IERCKAIVDLDTSLCKGFGFVQYYSFESCENCIRGFFYLGYQASFAQKSRNSRLKDLEDKSSTNIYCTNIPIDWT
EADLRRHFEPWRVVSEKISRDEKTGVSKEVGFARFENRDVAEKVLMEFHNVTKDDGVKLLLRFADTKAQKILKQQ
SNERRAYRAGEYNYSVEVVQGSTPSPGMKRGSHLTPNSQVSYTSPAGVGANWTPATSISPCHPHMKNPSSSARSS
SLSSRSLNALDHTPAYRSRALSLNRGSYTDLSGGSSKTAMPDSPTMGSRKENIRAGSVSPASSSPMIILSPARSC
T*
Coding >Pro_DTO377G3_2|g764.t1
ATGCACCCTCAGGGCTCTCAACACACAAGCTCCTCTGGTTCTGGCTCTTGTCAGACATCAAGCTCCCAGTCTGCA
CAATACCCCCAAGAGCCTCGTACACCCTATGGTCCCAGGTACCACCAATCTACCAATCCGAGTTCTATTGACAGC
AGTGGTGCAGGCCTGACCAATCTTTTCAGAGGATTAAATCTGCAGAACTCTCGTCCCAAATTCAACGGCTCAAAG
GGCACCGCACCCGTTCAAATGAACACAAACATGGACTGGTCGAATACCAACCGTGCATACAACAGCCCATTCATC
CTGGTTCCGAATTCCACCGTTTTCAATGGCGTTCCGACCGTCTCTTCCTTTGTTCCTAACGGTGTCTCTGGTCAG
ACTGATCAGATGGGCCAATTCTCGTATCTTCCAACGGGAGTCTACCCCAACGTCAATCCTGTGATGGCTGGTGGA
TACTCGTCGTGGCCCTACATGATGAACTACGACATGCAGGATGGGACGACCAACAAGCAAGCATGGGTGTCTGAG
GGCCAGAAGGGAGTTCAGGGGGAGAACAATGGACAAATAAATTACTATCCCTCTGCTCTTGTTTCTGGCATGGAT
GGCAGTTCCATGTCTGGTTACTCTTATGGAGGCATGGTTCCCTCGCAGCTTGGGTCGCTCTCGCTTCCCCTCCAA
ATGATGAAGACTCCCAACGGTTACGTCGTTCAAGATCTGGAGGCTCTAACTCAACAAGATCCTGCCATCCCACGC
GCGGTGCCTGCCATGTGGACTAACCCGTCTGAGCTGACACTCGCCAAGTGTCTGGAAAATCGCGAGGGTATAACC
AATGTCTACATCCGAGGATTCCTGCCCGAGACCACTGATGAGATGTTGCATGCCTACGCAGCTCGTTTCGGAAAG
ATTGAGCGTTGCAAGGCCATCGTGGACCTGGATACCAGTCTTTGCAAAGGATTCGGTTTTGTTCAGTATTACAGC
TTCGAATCCTGCGAGAACTGCATTCGCGGTTTCTTTTACCTCGGCTACCAAGCCAGCTTCGCCCAGAAGTCTCGC
AACTCTCGCCTGAAGGATCTGGAGGACAAGTCTTCTACCAATATATACTGCACCAACATTCCAATCGATTGGACT
GAAGCCGACCTGCGTCGTCATTTCGAGCCATGGCGTGTGGTTTCGGAAAAGATCAGTCGCGATGAGAAGACAGGT
GTGAGCAAGGAAGTGGGCTTTGCACGCTTCGAAAACCGTGATGTTGCCGAAAAGGTCCTGATGGAATTCCACAAC
GTCACCAAGGACGATGGGGTAAAGCTGCTTCTGCGCTTTGCTGATACCAAAGCGCAAAAGATCCTGAAGCAACAG
AGCAACGAACGTCGTGCTTACCGCGCCGGAGAATATAACTACTCGGTTGAAGTGGTTCAGGGATCTACTCCATCC
CCTGGGATGAAACGTGGCTCTCATCTTACTCCAAACTCTCAAGTCAGCTATACCTCTCCAGCTGGTGTGGGCGCT
AACTGGACCCCGGCAACTTCCATCTCCCCTTGTCACCCGCACATGAAGAATCCATCCAGCAGTGCACGAAGCAGT
TCCTTGTCGTCTCGGAGCCTCAATGCTCTTGACCACACGCCCGCCTATCGCAGTCGAGCCTTGTCCCTGAACCGC
GGCTCTTACACTGATCTCTCTGGTGGTTCTTCCAAGACCGCCATGCCGGACTCGCCGACTATGGGGTCTCGTAAA
GAGAACATCAGAGCGGGCTCTGTATCCCCCGCTTCTTCTTCTCCCATGATCATTCTCTCCCCAGCTCGCTCGTGC
ACTTAA
Transcript >Pro_DTO377G3_2|g764.t1
ATGCACCCTCAGGGCTCTCAACACACAAGCTCCTCTGGTTCTGGCTCTTGTCAGACATCAAGCTCCCAGTCTGCA
CAATACCCCCAAGAGCCTCGTACACCCTATGGTCCCAGGTACCACCAATCTACCAATCCGAGTTCTATTGACAGC
AGTGGTGCAGGCCTGACCAATCTTTTCAGAGGATTAAATCTGCAGAACTCTCGTCCCAAATTCAACGGCTCAAAG
GGCACCGCACCCGTTCAAATGAACACAAACATGGACTGGTCGAATACCAACCGTGCATACAACAGCCCATTCATC
CTGGTTCCGAATTCCACCGTTTTCAATGGCGTTCCGACCGTCTCTTCCTTTGTTCCTAACGGTGTCTCTGGTCAG
ACTGATCAGATGGGCCAATTCTCGTATCTTCCAACGGGAGTCTACCCCAACGTCAATCCTGTGATGGCTGGTGGA
TACTCGTCGTGGCCCTACATGATGAACTACGACATGCAGGATGGGACGACCAACAAGCAAGCATGGGTGTCTGAG
GGCCAGAAGGGAGTTCAGGGGGAGAACAATGGACAAATAAATTACTATCCCTCTGCTCTTGTTTCTGGCATGGAT
GGCAGTTCCATGTCTGGTTACTCTTATGGAGGCATGGTTCCCTCGCAGCTTGGGTCGCTCTCGCTTCCCCTCCAA
ATGATGAAGACTCCCAACGGTTACGTCGTTCAAGATCTGGAGGCTCTAACTCAACAAGATCCTGCCATCCCACGC
GCGGTGCCTGCCATGTGGACTAACCCGTCTGAGCTGACACTCGCCAAGTGTCTGGAAAATCGCGAGGGTATAACC
AATGTCTACATCCGAGGATTCCTGCCCGAGACCACTGATGAGATGTTGCATGCCTACGCAGCTCGTTTCGGAAAG
ATTGAGCGTTGCAAGGCCATCGTGGACCTGGATACCAGTCTTTGCAAAGGATTCGGTTTTGTTCAGTATTACAGC
TTCGAATCCTGCGAGAACTGCATTCGCGGTTTCTTTTACCTCGGCTACCAAGCCAGCTTCGCCCAGAAGTCTCGC
AACTCTCGCCTGAAGGATCTGGAGGACAAGTCTTCTACCAATATATACTGCACCAACATTCCAATCGATTGGACT
GAAGCCGACCTGCGTCGTCATTTCGAGCCATGGCGTGTGGTTTCGGAAAAGATCAGTCGCGATGAGAAGACAGGT
GTGAGCAAGGAAGTGGGCTTTGCACGCTTCGAAAACCGTGATGTTGCCGAAAAGGTCCTGATGGAATTCCACAAC
GTCACCAAGGACGATGGGGTAAAGCTGCTTCTGCGCTTTGCTGATACCAAAGCGCAAAAGATCCTGAAGCAACAG
AGCAACGAACGTCGTGCTTACCGCGCCGGAGAATATAACTACTCGGTTGAAGTGGTTCAGGGATCTACTCCATCC
CCTGGGATGAAACGTGGCTCTCATCTTACTCCAAACTCTCAAGTCAGCTATACCTCTCCAGCTGGTGTGGGCGCT
AACTGGACCCCGGCAACTTCCATCTCCCCTTGTCACCCGCACATGAAGAATCCATCCAGCAGTGCACGAAGCAGT
TCCTTGTCGTCTCGGAGCCTCAATGCTCTTGACCACACGCCCGCCTATCGCAGTCGAGCCTTGTCCCTGAACCGC
GGCTCTTACACTGATCTCTCTGGTGGTTCTTCCAAGACCGCCATGCCGGACTCGCCGACTATGGGGTCTCGTAAA
GAGAACATCAGAGCGGGCTCTGTATCCCCCGCTTCTTCTTCTCCCATGATCATTCTCTCCCCAGCTCGCTCGTGC
ACTTAA
Gene >Pro_DTO377G3_2|g764.t1
ATGCACCCTCAGGGCTCTCAACACACAAGCTCCTCTGGTTCTGGCTCTTGTCAGACATCAAGCTCCCAGTCTGCA
CAATACCCCCAAGAGCCTCGTACACCCTATGGTCCCAGGTACCACCAATCTACCAATCCGAGTTCTATTGACAGC
AGTGGTGCAGGCCTGACCAATCTTTTCAGAGGATTAAATCTGCAGAACTCTCGTCCCAAATTCAACGGCTCAAAG
GGCACCGCACCCGTTCAAATGAACACAAACATGGACTGGTCGAATACCAACCGTGCATACAACAGCCCATTCATC
CTGGTTCCGAATTCCACCGTTTTCAATGGCGTTCCGACCGTCTCTTCCTTTGTTCCTAACGGTGTCTCTGGTCAG
ACTGATCAGATGGGCCAATTCTCGTATCTTCCAACGGGAGTCTACCCCAACGTCAATCCTGTGATGGCTGGTGGA
TACTCGTCGTGGCCCTACATGATGAACTACGACATGCAGGATGGGACGACCAACAAGCAAGCATGGGTGTCTGAG
GGCCAGAAGGGAGTTCAGGGGGAGAACAATGGACAAATAAATTACTATCCCTCTGCTCTTGTTTCTGGCATGGAT
GGCAGTTCCATGTCTGGTTACTCTTATGGAGGCATGGTTCCCTCGCAGCTTGGGTCGCTCTCGCTTCCCCTCCAA
ATGATGAAGACTCCCAACGGTTACGTCGTTCAAGATCTGGAGGCTCTAACTCAACAAGATCCTGCCATCCCACGC
GCGGTGCCTGCCATGTGGACTAACCCGTCTGAGCTGACACTCGCCAAGTGTCTGGAAAATCGCGAGGGTATAACC
AATGTCTACATCCGAGGATTCCTGCCCGAGACCACTGATGAGATGTTGCATGCCTACGCAGCTCGTTTCGGAAAG
ATTGAGCGTTGCAAGGCCATCGTGGACCTGGATACCAGTCTTTGCAAAGGGTACCTACTCCACAAAACTTCTTTC
CGATAATTTATTCTAATCTTTTGCAGATTCGGTTTTGTTCAGTATTACAGCTTCGAATCCTGCGAGAACTGCATT
CGCGGTTTCTTTTACCTCGGCTACCAAGCCAGCTTCGCCCAGAAGTCTCGCAACTCTCGCCTGAAGGATCTGGAG
GACAAGTCTTCTACCAATATATACTGCACCAACATTCCAATCGATTGGACTGAAGCCGTGAGTTATACAAACCCC
CACACGCTTGTCTGTCCTGTTGAATTCTAATTAGTTTATCAGGACCTGCGTCGTCATTTCGAGCCATGGCGTGTG
GTTTCGGAAAAGATCAGTCGCGATGAGAAGACAGGTGTGAGCAAGGAAGTGGGCTTTGCACGGTAAAAAAGCAAA
TTCCTTCCTTGACTCTCATGACCTTTTCTGACTGGTTTACAGCTTCGAAAACCGTGATGTTGCCGAAAAGGTCCT
GATGGAATTCCACAACGTCACCAAGGACGATGGGGTAAAGCTGCTTCTGCGCTTTGCTGATACCAAAGCGCAAAA
GATCCTGAAGCAACAGAGCAACGAACGTCGTGCTTACCGCGCCGGAGAATATAACTACTCGGTTGAAGTGGTTCA
GGGATCTACTCCATCCCCTGGGATGAAACGTGGCTCTCATCTTACTCCAAACTCTCAAGTCAGCTATACCTCTCC
AGCTGGTGTGGGCGCTAACTGGACCCCGGCAACTTCCATCTCCCCTTGGTATGTCTAAATACTTGAACTGCATTC
CAAAACTCATTCTAATCGAGCTCACAGTCACCCGCACATGAAGAATCCATCCAGCAGTGCACGAAGCAGTTCCTT
GTCGTCTCGGAGCCTCAATGCTCTTGACCACACGCCCGCCTATCGCAGTCGAGCCTTGTCCCTGAACCGCGGCTC
TTACACTGATCTCTCTGGTGGTTCTTCCAAGACCGCCATGCCGGACTCGCCGACTATGGGGTCTCGTAAAGAGAA
CATCAGAGCGGGCTCTGTATCCCCCGCTTCTTCTTCTCCCATGATCATTCTCTCCCCAGCTCGCTCGTGCACTTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail