Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7622.t1
Gene name
Locationscaffold_24:340980..342140
Strand+
Gene length (bp)1160
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family 3.1E-38 9 241

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 51.36 28.58 74.14
5d_25C Five days - 25 degrees Celsius 54.47 30.61 78.33
7d_25C Seven days - 25 degrees Celsius 57.60 32.68 82.53
10d_25C Ten days - 25 degrees Celsius 81.03 47.88 114.17
7d_15C Seven days - 15 degrees Celsius 42.44 22.66 62.22
7d_30C Seven days - 30 degrees Celsius 56.01 31.46 80.55

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.872386 no
3d_25C 7d_25C 0.714412 no
3d_25C 7d_15C 0.519082 no
3d_25C 7d_30C 0.798345 no
3d_25C 10d_25C 0.045183 yes
5d_25C 7d_25C 0.875545 no
5d_25C 7d_15C 0.369321 no
5d_25C 7d_30C 0.943522 no
5d_25C 10d_25C 0.091904 no
7d_25C 7d_15C 0.237292 no
7d_25C 7d_30C 0.940770 no
7d_25C 10d_25C 0.149982 no
7d_15C 7d_30C 0.303490 no
7d_15C 10d_25C 0.004045 yes
7d_30C 10d_25C 0.128879 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7622.t1
MAARNTLRRSLLYVPGSSQRFLDKSRSLTADCVTYDLEDSVTPHMKAEARSLVRRAIDQAAPPGIRERAVRINSV
DSGLALGDLTEVLQSPNLTTIVIPKVNSASDLTFVTDVITHTLSQQPPTEGTRTPISLLALVESAKSLTNLSQIC
TASPLLQGLIFAAEDFALDLSITRTPSLTEFLFARCAIATAARAAELPSTIDLVCTAYRSEKGDGSPPAVLQEEC
LDGRRLGFNGKQCIHPSQVKVADQIFGPDPHETEWAMRVVIADDKAARAGRGAWTLDGKMIDVPVANKARAIVKK
AEACGVDVDALRKEWQHQEPE*
Coding >Pro_DTO377G3_2|g7622.t1
ATGGCAGCCCGAAATACTCTGCGTCGTTCCCTCCTCTACGTCCCCGGCTCCTCCCAACGCTTTCTAGATAAGTCG
CGCTCACTGACCGCCGACTGCGTCACCTACGACCTGGAAGACAGCGTGACTCCGCACATGAAAGCAGAGGCGCGC
TCGCTAGTGCGGAGAGCAATTGACCAAGCCGCGCCACCAGGAATCCGGGAACGCGCCGTGCGAATCAATTCCGTA
GACAGCGGACTCGCATTGGGTGATTTGACCGAAGTCCTCCAATCACCAAACCTAACAACAATCGTAATCCCAAAA
GTCAACTCTGCCTCCGACCTAACATTCGTCACAGACGTCATAACCCACACTCTATCCCAGCAACCACCAACAGAA
GGAACAAGAACCCCAATCTCACTCCTGGCTCTAGTCGAGTCCGCCAAGTCCCTGACAAACCTATCCCAGATCTGC
ACTGCTTCGCCCTTGCTCCAAGGCTTAATCTTCGCAGCCGAAGACTTCGCCCTAGACCTGAGCATCACGCGGACG
CCCTCGCTCACAGAGTTTCTGTTCGCGCGATGTGCGATAGCCACCGCTGCGCGGGCGGCGGAGCTACCGTCAACG
ATTGACCTTGTCTGCACGGCGTACAGGTCTGAGAAGGGGGATGGGTCGCCGCCAGCTGTGCTACAGGAAGAGTGT
CTGGATGGGCGCCGGTTGGGGTTCAATGGGAAGCAGTGTATTCATCCTTCGCAAGTGAAGGTTGCGGATCAGATC
TTTGGGCCAGATCCGCATGAGACTGAGTGGGCTATGCGGGTTGTTATTGCGGATGATAAGGCTGCGAGGGCGGGG
AGGGGTGCTTGGACTCTTGATGGGAAGATGATTGATGTTCCTGTTGCCAATAAGGCTAGGGCTATTGTCAAAAAG
GCTGAGGCTTGTGGGGTTGATGTTGATGCTTTGAGGAAGGAGTGGCAGCATCAGGAACCAGAGTAG
Transcript >Pro_DTO377G3_2|g7622.t1
ATGGCAGCCCGAAATACTCTGCGTCGTTCCCTCCTCTACGTCCCCGGCTCCTCCCAACGCTTTCTAGATAAGTCG
CGCTCACTGACCGCCGACTGCGTCACCTACGACCTGGAAGACAGCGTGACTCCGCACATGAAAGCAGAGGCGCGC
TCGCTAGTGCGGAGAGCAATTGACCAAGCCGCGCCACCAGGAATCCGGGAACGCGCCGTGCGAATCAATTCCGTA
GACAGCGGACTCGCATTGGGTGATTTGACCGAAGTCCTCCAATCACCAAACCTAACAACAATCGTAATCCCAAAA
GTCAACTCTGCCTCCGACCTAACATTCGTCACAGACGTCATAACCCACACTCTATCCCAGCAACCACCAACAGAA
GGAACAAGAACCCCAATCTCACTCCTGGCTCTAGTCGAGTCCGCCAAGTCCCTGACAAACCTATCCCAGATCTGC
ACTGCTTCGCCCTTGCTCCAAGGCTTAATCTTCGCAGCCGAAGACTTCGCCCTAGACCTGAGCATCACGCGGACG
CCCTCGCTCACAGAGTTTCTGTTCGCGCGATGTGCGATAGCCACCGCTGCGCGGGCGGCGGAGCTACCGTCAACG
ATTGACCTTGTCTGCACGGCGTACAGGTCTGAGAAGGGGGATGGGTCGCCGCCAGCTGTGCTACAGGAAGAGTGT
CTGGATGGGCGCCGGTTGGGGTTCAATGGGAAGCAGTGTATTCATCCTTCGCAAGTGAAGGTTGCGGATCAGATC
TTTGGGCCAGATCCGCATGAGACTGAGTGGGCTATGCGGGTTGTTATTGCGGATGATAAGGCTGCGAGGGCGGGG
AGGGGTGCTTGGACTCTTGATGGGAAGATGATTGATGTTCCTGTTGCCAATAAGGCTAGGGCTATTGTCAAAAAG
GCTGAGGCTTGTGGGGTTGATGTTGATGCTTTGAGGAAGGAGTGGCAGCATCAGGAACCAGAGTAG
Gene >Pro_DTO377G3_2|g7622.t1
ATGGCAGCCCGAAATACTCTGCGTCGTTCCCTCCTCTACGGTAAGCTCGAGCTCCCTTCCAAAGCCGCATCGCAT
CCCGAGGTCTTCCCCGCATTTCACCCCGAACTCCAAAAGAAAAACCCCAGAGCTAACCAACAACGCCAAACAGTC
CCCGGCTCCTCCCAACGCTTTCTAGATAAGTCGCGCTCACTGACCGCCGACTGCGTCACCTACGACCTGGAAGAC
AGCGTGACTCCGCACATGAAAGCAGAGGCGCGCTCGCTAGTGCGGAGAGCAATTGACCAAGCCGCGCCACCAGGA
ATCCGGGAACGCGCCGTGCGAATCAATTCCGTAGACAGCGGACTCGCATTGGGTGATTTGACCGAAGTCGTGAGT
GGACTCCAGAACATACACACACACATAGCTCCCACCCCCTTCCACCACCCTGGTAACATTCAACTTGCTAACCGT
CCCAGCTCCAATCACCAAACCTAACAACAATCGTAATCCCAAAAGTCAACTCTGCCTCCGACCTAACATTCGTCA
CAGACGTCATAACCCACACTCTATCCCAGCAACCACCAACAGAAGGAACAAGAACCCCAATCTCACTCCTGGCTC
TAGTCGAGTCCGCCAAGTCCCTGACAAACCTATCCCAGATCTGCACTGCTTCGCCCTTGCTCCAAGGCTTAATCT
TCGCAGCCGAAGACTTCGCCCTAGACCTGAGCATCACGCGGACGCCCTCGCTCACAGAGTTTCTGTTCGCGCGAT
GTGCGATAGCCACCGCTGCGCGGGCGGCGGAGCTACCGTCAACGATTGACCTTGTCTGCACGGCGTACAGGTCTG
AGAAGGGGGATGGGTCGCCGCCAGCTGTGCTACAGGAAGAGTGTCTGGATGGGCGCCGGTTGGGGTTCAATGGGA
AGCAGTGTATTCATCCTTCGCAAGTGAAGGTTGCGGATCAGATCTTTGGGCCAGATCCGCATGAGACTGAGTGGG
CTATGCGGGTTGTTATTGCGGATGATAAGGCTGCGAGGGCGGGGAGGGGTGCTTGGACTCTTGATGGGAAGATGA
TTGATGTTCCTGTTGCCAATAAGGCTAGGGCTATTGTCAAAAAGGCTGAGGCTTGTGGGGTTGATGTTGATGCTT
TGAGGAAGGAGTGGCAGCATCAGGAACCAGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail