Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7597.t1
Gene name
Locationscaffold_24:271139..271867
Strand+
Gene length (bp)728
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.4E-12 18 143
PF13419 HAD_2 Haloacid dehalogenase-like hydrolase 5.1E-10 30 147
PF13242 Hydrolase_like HAD-hyrolase-like 2.4E-05 105 156

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 17.25 5.56 28.95
5d_25C Five days - 25 degrees Celsius 17.23 5.51 28.96
7d_25C Seven days - 25 degrees Celsius 19.67 6.34 33.00
10d_25C Ten days - 25 degrees Celsius 12.63 3.39 21.86
7d_15C Seven days - 15 degrees Celsius 34.83 14.51 55.14
7d_30C Seven days - 30 degrees Celsius 25.82 9.79 41.84

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.997772 no
3d_25C 7d_25C 0.807151 no
3d_25C 7d_15C 0.046757 yes
3d_25C 7d_30C 0.304983 no
3d_25C 10d_25C 0.504569 no
5d_25C 7d_25C 0.803667 no
5d_25C 7d_15C 0.047876 yes
5d_25C 7d_30C 0.297205 no
5d_25C 10d_25C 0.502019 no
7d_25C 7d_15C 0.108295 no
7d_25C 7d_30C 0.525076 no
7d_25C 10d_25C 0.304520 no
7d_15C 7d_30C 0.426301 no
7d_15C 10d_25C 0.003197 yes
7d_30C 10d_25C 0.051079 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7597.t1
MFRQMREALGIDSSVDILHHIRQLPTEEQPTAVSKVQAVERRAMADQQPQPGLVLLMDYLESRGVRRALCTRNFE
APVQNLIDNHLNGHVFLPIITRDTPNLLPKPDPAGILHIASEWGLDDGRNLIMVGDSIDDMTAGHMAGAATVLLL
NEHNVHLKEHPHTDLCIKQLSDLIDVLEAGFVGTRENDEHGA*
Coding >Pro_DTO377G3_2|g7597.t1
ATGTTCCGTCAGATGAGAGAAGCACTAGGAATCGACAGCTCCGTCGATATCCTCCACCACATCCGCCAACTCCCC
ACCGAAGAACAACCCACAGCCGTATCGAAGGTGCAAGCAGTAGAGCGCCGAGCCATGGCCGACCAGCAGCCGCAG
CCCGGCCTGGTTCTCCTAATGGACTACCTTGAATCCCGCGGCGTACGACGAGCGCTCTGCACACGGAACTTCGAA
GCACCAGTCCAGAACCTGATTGACAATCATCTCAACGGTCATGTCTTCCTACCAATCATCACGCGGGACACGCCA
AATCTCCTGCCCAAGCCTGATCCCGCCGGCATTCTGCATATTGCGAGTGAATGGGGTCTTGATGATGGTCGGAAT
TTGATCATGGTTGGTGATAGCATTGATGATATGACGGCTGGGCATATGGCTGGCGCTGCGACGGTGTTGCTTTTG
AATGAGCATAATGTGCATTTGAAGGAACATCCGCATACGGATCTTTGCATTAAGCAGCTATCTGATTTGATCGAT
GTTCTGGAGGCAGGATTTGTCGGGACTAGAGAGAACGATGAGCATGGCGCGTGA
Transcript >Pro_DTO377G3_2|g7597.t1
ATGTTCCGTCAGATGAGAGAAGCACTAGGAATCGACAGCTCCGTCGATATCCTCCACCACATCCGCCAACTCCCC
ACCGAAGAACAACCCACAGCCGTATCGAAGGTGCAAGCAGTAGAGCGCCGAGCCATGGCCGACCAGCAGCCGCAG
CCCGGCCTGGTTCTCCTAATGGACTACCTTGAATCCCGCGGCGTACGACGAGCGCTCTGCACACGGAACTTCGAA
GCACCAGTCCAGAACCTGATTGACAATCATCTCAACGGTCATGTCTTCCTACCAATCATCACGCGGGACACGCCA
AATCTCCTGCCCAAGCCTGATCCCGCCGGCATTCTGCATATTGCGAGTGAATGGGGTCTTGATGATGGTCGGAAT
TTGATCATGGTTGGTGATAGCATTGATGATATGACGGCTGGGCATATGGCTGGCGCTGCGACGGTGTTGCTTTTG
AATGAGCATAATGTGCATTTGAAGGAACATCCGCATACGGATCTTTGCATTAAGCAGCTATCTGATTTGATCGAT
GTTCTGGAGGCAGGATTTGTCGGGACTAGAGAGAACGATGAGCATGGCGCGTGA
Gene >Pro_DTO377G3_2|g7597.t1
ATGTTCCGTCAGATGAGGTATGCTCTACTGCCTGCGAGCCATTCAAACCCCTCTGTAACAAATATTCCACTATAG
AGAAGCACTAGGAATCGACAGCTCCGTCGATATCCTCCACCACATCCGCCAACTCCCCACCGAAGAACAACCCAC
AGCCGTATCGAAGGTGCAAGCAGTAGAGCGCCGAGCCATGGCCGACCAGCAGCCGCAGCCCGGCCTGGTTCTCCT
AATGGACTACCTTGAATCCCGCGGCGTACGACGAGCGCTCTGCACACGGAACTTCGAGTACGTTGTAGTTATCAA
CGCAACCTTCCACATGCATTCTAGATACGTACTGTAATGTGCACACAACGCTAACCTATATTCGCATCTTTAGAG
CACCAGTCCAGAACCTGATTGACAATCATCTCAACGGTCATGTCTTCCTACCAATCATCACGCGGGACACGCCAA
ATCTCCTGCCCAAGCCTGATCCCGCCGGCATTCTGCATATTGCGAGTGAATGGGGTCTTGATGATGGTCGGAATT
TGATCATGGTTGGTGATAGCATTGATGATATGACGGCTGGGCATATGGCTGGCGCTGCGACGGTGTTGCTTTTGA
ATGAGCATAATGTGCATTTGAAGGAACATCCGCATACGGATCTTTGCATTAAGCAGCTATCTGATTTGATCGATG
TTCTGGAGGCAGGATTTGTCGGGACTAGAGAGAACGATGAGCATGGCGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail