Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7588.t1
Gene name
Locationscaffold_24:246309..248556
Strand-
Gene length (bp)2247
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.5E-167 166 612
PF14558 TRP_N ML-like domain 1.3E-36 24 161

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 333 355 22
2 382 401 19
3 416 433 17
4 474 496 22
5 506 525 19
6 532 551 19
7 561 594 33

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 125.32 75.54 175.11
5d_25C Five days - 25 degrees Celsius 56.96 32.76 81.16
7d_25C Seven days - 25 degrees Celsius 63.04 34.65 91.43
10d_25C Ten days - 25 degrees Celsius 27.80 14.70 40.90
7d_15C Seven days - 15 degrees Celsius 72.22 37.64 106.80
7d_30C Seven days - 30 degrees Celsius 63.82 35.43 92.22

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.002297 yes
3d_25C 7d_15C 0.017762 yes
3d_25C 7d_30C 0.002761 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.763961 no
5d_25C 7d_15C 0.393457 no
5d_25C 7d_30C 0.730170 no
5d_25C 10d_25C 0.002761 yes
7d_25C 7d_15C 0.685751 no
7d_25C 7d_30C 0.976137 no
7d_25C 10d_25C 0.000700 yes
7d_15C 7d_30C 0.717322 no
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7588.t1
MRVISLLTCFVAFLAPLASAVQLLESNALSVCMESSNFTATYFSVIFYPGNNSLVVGFDGVSYIEGKVIAEMTFT
AYGYQAYQSTLNPCKISGMGMCPMSAGPMDLGPLSLDLPAGTSANIPGIAFSVPDLDAKVRIVIRTADTEEKIAC
VEASLSNGKTVNQSGVSWTTAVISGLGLAASAITSGLGHSNTAAHVAANALSLFGFMQSQAIIGMTSVDMPPIVE
AWTQNFQWSMGIIRVGFIQTIATWYQRSTGGTPSTVLSQLSDTSVEVLRRRKRALVDPAMNLMRRAVGPMIVKRG
SGIVKRAETSQKLLVIRGIDRVGFRADMEDTNIFLTGLIFFAVFTCIVVIIVALFKGITELLVKHGKMKSDRFQD
FRNGWKIVLRGILFRLTLIGFPQMSILCLWEFTQRDSPAEIVLAAVMLLSMLVSLGWASQKVIRLAKRSVTMHKN
PAYILYSDPTCLNKWGFLYVQYRATAYYFVVPFLVYTLIKGMFIGLSQEAPVVQTVALVVLELGMLVAVCILRPW
MDKKTNVFNISIAVINFINSIFLLVFSDVFDPPGMMIGVMGVIFFVYNAVFSLVLLILVLLASIYAVVSKNPDTR
YQPMRDDRGSFIKSQTQLTTELDALGATARGDMKPGQYNNNNPFDDDSASISSGNGATVGRPMESTYSLHGSAAQ
APRSPVDPSVPLFPSNASGHHNPPPGYDHYGRSPSPAPRSFDNTSPVGQSALSTTYRAQNSASPWQRGAGYDH*
Coding >Pro_DTO377G3_2|g7588.t1
ATGCGGGTAATATCTCTTCTCACCTGCTTCGTCGCCTTTCTGGCGCCGCTAGCCTCTGCCGTCCAACTCCTTGAA
TCCAATGCACTCAGCGTGTGCATGGAAAGTAGCAACTTCACGGCAACATATTTCAGCGTCATCTTCTACCCAGGA
AATAACTCCCTCGTGGTCGGCTTCGATGGCGTCTCATACATCGAGGGTAAGGTTATTGCGGAGATGACCTTCACC
GCATATGGCTACCAGGCATATCAGAGCACCCTTAATCCTTGTAAAATTAGTGGCATGGGTATGTGTCCCATGTCC
GCTGGACCCATGGATTTGGGTCCACTTTCTCTCGACCTCCCAGCAGGCACTTCAGCCAATATCCCTGGTATCGCC
TTCAGTGTGCCTGATCTCGACGCAAAAGTGCGGATTGTCATCAGGACAGCCGACACCGAAGAAAAGATTGCTTGT
GTCGAGGCCTCACTTTCCAACGGCAAGACCGTTAATCAATCCGGAGTCTCGTGGACAACTGCTGTTATATCCGGG
TTAGGTCTCGCTGCATCCGCTATCACCTCCGGCCTAGGGCATTCCAACACCGCAGCCCACGTTGCGGCAAATGCG
CTCTCTCTTTTCGGATTCATGCAGTCCCAAGCGATTATTGGCATGACCTCCGTTGATATGCCCCCGATCGTGGAA
GCTTGGACCCAGAACTTCCAATGGAGCATGGGTATCATCCGCGTGGGATTCATCCAGACGATTGCTACCTGGTAT
CAGCGATCAACCGGTGGAACTCCATCGACAGTCCTATCACAGCTTTCGGATACTTCTGTGGAAGTCCTCAGGCGC
CGTAAGCGTGCCTTGGTTGACCCGGCCATGAACCTCATGAGGAGAGCCGTGGGACCAATGATTGTCAAGCGAGGA
AGTGGTATAGTCAAGAGAGCCGAGACAAGCCAGAAACTTCTTGTCATCCGAGGAATTGATCGTGTTGGATTCCGT
GCGGACATGGAGGATACCAACATTTTCCTCACTGGCCTGATTTTCTTTGCGGTATTCACCTGCATTGTCGTCATC
ATCGTTGCACTCTTCAAGGGAATTACTGAGTTACTTGTCAAGCATGGCAAAATGAAGAGCGACCGGTTCCAGGAC
TTCCGCAATGGGTGGAAGATCGTACTGCGTGGTATCTTGTTCCGATTGACTCTCATCGGGTTTCCCCAGATGTCT
ATCCTTTGCCTCTGGGAGTTCACCCAGCGTGACTCGCCGGCCGAGATTGTTTTGGCAGCGGTCATGCTCCTTTCC
ATGCTCGTCTCTCTTGGTTGGGCCTCTCAGAAGGTCATCCGTTTGGCAAAGCGTTCAGTTACCATGCACAAGAAC
CCGGCATATATTCTTTACTCCGACCCAACCTGTCTGAACAAGTGGGGTTTTTTGTATGTGCAGTACCGAGCAACG
GCATACTACTTTGTCGTTCCGTTCCTCGTCTACACCTTGATCAAGGGTATGTTCATCGGTCTGAGCCAGGAAGCA
CCGGTCGTTCAAACAGTGGCTTTGGTGGTCCTTGAGCTAGGCATGCTTGTTGCGGTCTGCATTCTCCGTCCTTGG
ATGGATAAGAAGACCAACGTTTTCAACATCTCCATTGCGGTGATCAATTTCATCAACTCCATCTTCCTGCTCGTG
TTCTCGGATGTGTTCGACCCACCCGGAATGATGATCGGTGTTATGGGTGTCATTTTCTTCGTTTACAATGCCGTG
TTTTCTTTGGTCCTCTTGATCTTGGTCCTGCTCGCCTCGATATATGCCGTTGTGTCAAAGAATCCCGACACTCGT
TACCAGCCTATGCGCGACGATCGTGGCTCGTTCATCAAGTCCCAAACCCAGCTCACCACTGAATTGGATGCCTTG
GGTGCTACCGCACGTGGTGATATGAAGCCTGGACAATATAATAATAACAACCCATTCGACGACGATAGCGCTTCT
ATCTCCAGTGGAAACGGTGCTACCGTCGGCCGCCCAATGGAATCGACCTACTCCCTGCACGGGTCTGCCGCCCAA
GCGCCTCGGTCACCCGTTGACCCATCCGTGCCACTGTTCCCCAGCAACGCGTCAGGTCATCACAATCCTCCCCCC
GGATACGACCATTACGGCCGGTCCCCTTCACCCGCGCCAAGGAGCTTTGATAACACCTCTCCTGTTGGCCAATCT
GCTTTGTCAACGACATATCGAGCCCAGAACAGTGCCAGTCCTTGGCAACGAGGCGCTGGCTATGATCATTAA
Transcript >Pro_DTO377G3_2|g7588.t1
ATGCGGGTAATATCTCTTCTCACCTGCTTCGTCGCCTTTCTGGCGCCGCTAGCCTCTGCCGTCCAACTCCTTGAA
TCCAATGCACTCAGCGTGTGCATGGAAAGTAGCAACTTCACGGCAACATATTTCAGCGTCATCTTCTACCCAGGA
AATAACTCCCTCGTGGTCGGCTTCGATGGCGTCTCATACATCGAGGGTAAGGTTATTGCGGAGATGACCTTCACC
GCATATGGCTACCAGGCATATCAGAGCACCCTTAATCCTTGTAAAATTAGTGGCATGGGTATGTGTCCCATGTCC
GCTGGACCCATGGATTTGGGTCCACTTTCTCTCGACCTCCCAGCAGGCACTTCAGCCAATATCCCTGGTATCGCC
TTCAGTGTGCCTGATCTCGACGCAAAAGTGCGGATTGTCATCAGGACAGCCGACACCGAAGAAAAGATTGCTTGT
GTCGAGGCCTCACTTTCCAACGGCAAGACCGTTAATCAATCCGGAGTCTCGTGGACAACTGCTGTTATATCCGGG
TTAGGTCTCGCTGCATCCGCTATCACCTCCGGCCTAGGGCATTCCAACACCGCAGCCCACGTTGCGGCAAATGCG
CTCTCTCTTTTCGGATTCATGCAGTCCCAAGCGATTATTGGCATGACCTCCGTTGATATGCCCCCGATCGTGGAA
GCTTGGACCCAGAACTTCCAATGGAGCATGGGTATCATCCGCGTGGGATTCATCCAGACGATTGCTACCTGGTAT
CAGCGATCAACCGGTGGAACTCCATCGACAGTCCTATCACAGCTTTCGGATACTTCTGTGGAAGTCCTCAGGCGC
CGTAAGCGTGCCTTGGTTGACCCGGCCATGAACCTCATGAGGAGAGCCGTGGGACCAATGATTGTCAAGCGAGGA
AGTGGTATAGTCAAGAGAGCCGAGACAAGCCAGAAACTTCTTGTCATCCGAGGAATTGATCGTGTTGGATTCCGT
GCGGACATGGAGGATACCAACATTTTCCTCACTGGCCTGATTTTCTTTGCGGTATTCACCTGCATTGTCGTCATC
ATCGTTGCACTCTTCAAGGGAATTACTGAGTTACTTGTCAAGCATGGCAAAATGAAGAGCGACCGGTTCCAGGAC
TTCCGCAATGGGTGGAAGATCGTACTGCGTGGTATCTTGTTCCGATTGACTCTCATCGGGTTTCCCCAGATGTCT
ATCCTTTGCCTCTGGGAGTTCACCCAGCGTGACTCGCCGGCCGAGATTGTTTTGGCAGCGGTCATGCTCCTTTCC
ATGCTCGTCTCTCTTGGTTGGGCCTCTCAGAAGGTCATCCGTTTGGCAAAGCGTTCAGTTACCATGCACAAGAAC
CCGGCATATATTCTTTACTCCGACCCAACCTGTCTGAACAAGTGGGGTTTTTTGTATGTGCAGTACCGAGCAACG
GCATACTACTTTGTCGTTCCGTTCCTCGTCTACACCTTGATCAAGGGTATGTTCATCGGTCTGAGCCAGGAAGCA
CCGGTCGTTCAAACAGTGGCTTTGGTGGTCCTTGAGCTAGGCATGCTTGTTGCGGTCTGCATTCTCCGTCCTTGG
ATGGATAAGAAGACCAACGTTTTCAACATCTCCATTGCGGTGATCAATTTCATCAACTCCATCTTCCTGCTCGTG
TTCTCGGATGTGTTCGACCCACCCGGAATGATGATCGGTGTTATGGGTGTCATTTTCTTCGTTTACAATGCCGTG
TTTTCTTTGGTCCTCTTGATCTTGGTCCTGCTCGCCTCGATATATGCCGTTGTGTCAAAGAATCCCGACACTCGT
TACCAGCCTATGCGCGACGATCGTGGCTCGTTCATCAAGTCCCAAACCCAGCTCACCACTGAATTGGATGCCTTG
GGTGCTACCGCACGTGGTGATATGAAGCCTGGACAATATAATAATAACAACCCATTCGACGACGATAGCGCTTCT
ATCTCCAGTGGAAACGGTGCTACCGTCGGCCGCCCAATGGAATCGACCTACTCCCTGCACGGGTCTGCCGCCCAA
GCGCCTCGGTCACCCGTTGACCCATCCGTGCCACTGTTCCCCAGCAACGCGTCAGGTCATCACAATCCTCCCCCC
GGATACGACCATTACGGCCGGTCCCCTTCACCCGCGCCAAGGAGCTTTGATAACACCTCTCCTGTTGGCCAATCT
GCTTTGTCAACGACATATCGAGCCCAGAACAGTGCCAGTCCTTGGCAACGAGGCGCTGGCTATGATCATTAA
Gene >Pro_DTO377G3_2|g7588.t1
ATGCGGGTAATATCTCTTCTCACCTGCTTCGTCGCCTTTCTGGCGCCGCTAGCCTCTGCCGTCCAACTCCTTGAA
TCCAATGCACTCAGCGTGTGCATGGAAAGTAGCAACTTCACGGCAACATATTTCAGCGTCATCTTCTACCCAGGA
AATAACTCCCTCGTGGTCGGCTTCGATGGCGTCTCATACATCGAGGGTAAGGTTATTGCGGAGATGACCTTCACC
GCATATGGCTACCAGGCATATCAGAGCACCCTTAATCCTTGTAAAATTAGTGGCATGGGTATGTGTCCCATGTCC
GCTGGACCCATGGATTTGGGTCCACTTTCTCTCGACCTCCCAGCAGGCACTTCAGCCAATATCCCTGGTATCGCC
TTCAGTGTGCCTGATCTCGACGCAAAAGTGCGGATTGTCATCAGGACAGCCGACACCGAAGAAAAGATTGCTTGT
GTCGAGGCCTCACTTTCCAACGGCAAGACCGTTAATCAATCCGGAGTCTCGTGGACAACTGCTGTTATATCCGGG
TTAGGTCTCGCTGCATCCGCTATCACCTCCGGCCTAGGGCATTCCAACACCGCAGCCCACGTTGCGGCAAATGCG
CTCTCTCTTTTCGGATTCATGCAGTCCCAAGCGATTATTGGCATGACCTCCGTTGATATGCCCCCGATCGTGGAA
GCTTGGACCCAGAACTTCCAATGGAGCATGGGTATCATCCGCGTGGGATTCATCCAGACGATTGCTACCTGGTAT
CAGCGATCAACCGGTGGAACTCCATCGACAGTCCTATCACAGCTTTCGGATACTTCTGTGGAAGTCCTCAGGCGC
CGTAAGCGTGCCTTGGTTGACCCGGCCATGAACCTCATGAGGAGAGCCGTGGGACCAATGATTGTCAAGCGAGGA
AGTGGTATAGTCAAGAGAGCCGAGACAAGCCAGAAACTTCTTGTCATCCGAGGAATTGATCGTGTTGGATTCCGT
GCGGACATGGAGGATACCAACATTTTCCTCACTGGCCTGATTTTCTTTGCGGTATTCACCTGCATTGTCGTCATC
ATCGTTGCACTCTTCAAGGGAATTACTGAGTTACTTGTCAAGCATGGCAAAATGAAGAGCGACCGGTTCCAGGAC
TTCCGCAATGGGTGGAAGATCGTACTGCGTGGTATCTTGTTCCGATTGACTCTCATCGGGTTTCCCCAGATGTCT
ATCCTTTGCCTCTGGGAGTTCACCCAGCGTGACTCGCCGGCCGAGATTGTTTTGGCAGCGGTCATGCTCCTTTCC
ATGCTCGTCTCTCTTGGTTGGGCCTCTCAGAAGGTCATCCGTTTGGCAAAGCGTTCAGTTACCATGCACAAGAAC
CCGGCATATATTCTTTACTCCGACCCAACCTGTCTGAACAAGTGGGGTTTTTTGTATGTGCAGTACCGAGCAACG
GCATACTACTTTGTCGTTCCGTTCCTCGTCTACACCTTGATCAAGGGTATGTTCATCGGTCTGAGCCAGGAAGCA
CCGGTCGTTCAAACAGTGGCTTTGGTGGTCCTTGAGCTAGGCATGCTTGTTGCGGTCTGCATTCTCCGTCCTTGG
ATGGATAAGAAGACCAACGTTTTCAACATCTCCATTGCGGTGATCAATTTCATCAACTCCATCTTCCTGCTCGTG
TTCTCGGATGTGTTCGACCCACCCGGAATGATGATCGGTGTTATGGGTGTCATTTTCTTCGTTTACAATGCCGTG
TTTTCTTTGGTCCTCTTGATCTTGGTCCTGCTCGCCTCGATATATGCCGTTGTGTCAAAGAATCCCGACACTCGT
TACCAGCCTATGCGCGACGATCGTGGCTCGTTCATCAAGTCCCAAACCCAGCTCACCACTGAATTGGATGCCTTG
GGTGCTACCGCACGTGGTGATATGAAGCCTGGACAATATAATAATAACAACCCATTCGACGACGATAGCGCTTCT
ATCTCCAGTGGAAACGGTGCTACCGTCGGCCGCCCAATGGAATCGACCTACTCCCTGCACGGGTCTGCCGCCCAA
GCGCCTCGGTCACCCGTTGACCCATCCGTGCCACTGTTCCCCAGCAACGCGTCAGGTCATCACAATCCTCCCCCC
GGATACGACCATTACGGCCGGTCCCCTTCACCCGCGCCAAGGAGCTTTGATAACACCTCTCCTGTTGGCCAATCT
GCTTTGTCAACGACATATCGAGCCCAGAACAGTGCCAGTCCTTGGCAACGAGGCGCTGGCTATGATCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail