Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7581.t1
Gene name
Locationscaffold_24:224341..224830
Strand-
Gene length (bp)489
Transcript length (bp)489
Coding sequence length (bp)489
Protein length (aa) 163

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12223 DUF3602 Protein of unknown function (DUF3602) 1.9E-19 32 109

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 90.90 45.84 135.96
5d_25C Five days - 25 degrees Celsius 75.13 36.20 114.05
7d_25C Seven days - 25 degrees Celsius 88.58 44.14 133.02
10d_25C Ten days - 25 degrees Celsius 137.58 76.42 198.74
7d_15C Seven days - 15 degrees Celsius 56.44 25.17 87.71
7d_30C Seven days - 30 degrees Celsius 151.12 82.28 219.95

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.589175 no
3d_25C 7d_25C 0.955797 no
3d_25C 7d_15C 0.110542 no
3d_25C 7d_30C 0.048261 yes
3d_25C 10d_25C 0.116284 no
5d_25C 7d_25C 0.650976 no
5d_25C 7d_15C 0.409555 no
5d_25C 7d_30C 0.006000 yes
5d_25C 10d_25C 0.021670 yes
7d_25C 7d_15C 0.129002 no
7d_25C 7d_30C 0.031528 yes
7d_25C 10d_25C 0.093107 no
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.781968 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7581.t1
MPSSNYRVVEPHPSVPHAGRPAVYTGRGGCGNVVNLKNTKTTDSRSASGPASLARLDSRLPTSFVSGRGGAGNIH
SSSERAIFSFDEELERDLRQAAPVYHVGRGGAGNTIFRDDCSNSILTRKYSAGSTATNSSTGSVADRARDMARRG
LEKGWGKLKGTA*
Coding >Pro_DTO377G3_2|g7581.t1
ATGCCTTCTTCAAATTACCGCGTCGTTGAGCCGCACCCATCTGTCCCCCACGCCGGTCGCCCAGCAGTCTACACC
GGCCGTGGCGGATGTGGAAACGTCGTCAACCTCAAGAACACCAAGACCACCGACTCGCGCAGCGCCAGTGGACCA
GCCTCTCTCGCCCGTCTCGACTCGCGCCTGCCAACCAGCTTTGTCTCCGGCCGTGGCGGTGCTGGCAACATCCAC
AGCAGCAGCGAGCGCGCCATCTTCAGCTTCGACGAAGAGCTCGAGCGTGACCTGCGCCAGGCTGCCCCCGTCTAC
CACGTCGGCCGTGGCGGTGCCGGCAACACCATCTTCCGCGACGACTGCAGCAATTCTATTCTGACTCGCAAGTAC
TCGGCTGGTAGTACGGCTACCAACTCCAGCACTGGCTCCGTGGCAGATCGGGCTCGTGACATGGCCCGTCGTGGT
CTCGAGAAGGGCTGGGGCAAGCTGAAGGGTACTGCCTAG
Transcript >Pro_DTO377G3_2|g7581.t1
ATGCCTTCTTCAAATTACCGCGTCGTTGAGCCGCACCCATCTGTCCCCCACGCCGGTCGCCCAGCAGTCTACACC
GGCCGTGGCGGATGTGGAAACGTCGTCAACCTCAAGAACACCAAGACCACCGACTCGCGCAGCGCCAGTGGACCA
GCCTCTCTCGCCCGTCTCGACTCGCGCCTGCCAACCAGCTTTGTCTCCGGCCGTGGCGGTGCTGGCAACATCCAC
AGCAGCAGCGAGCGCGCCATCTTCAGCTTCGACGAAGAGCTCGAGCGTGACCTGCGCCAGGCTGCCCCCGTCTAC
CACGTCGGCCGTGGCGGTGCCGGCAACACCATCTTCCGCGACGACTGCAGCAATTCTATTCTGACTCGCAAGTAC
TCGGCTGGTAGTACGGCTACCAACTCCAGCACTGGCTCCGTGGCAGATCGGGCTCGTGACATGGCCCGTCGTGGT
CTCGAGAAGGGCTGGGGCAAGCTGAAGGGTACTGCCTAG
Gene >Pro_DTO377G3_2|g7581.t1
ATGCCTTCTTCAAATTACCGCGTCGTTGAGCCGCACCCATCTGTCCCCCACGCCGGTCGCCCAGCAGTCTACACC
GGCCGTGGCGGATGTGGAAACGTCGTCAACCTCAAGAACACCAAGACCACCGACTCGCGCAGCGCCAGTGGACCA
GCCTCTCTCGCCCGTCTCGACTCGCGCCTGCCAACCAGCTTTGTCTCCGGCCGTGGCGGTGCTGGCAACATCCAC
AGCAGCAGCGAGCGCGCCATCTTCAGCTTCGACGAAGAGCTCGAGCGTGACCTGCGCCAGGCTGCCCCCGTCTAC
CACGTCGGCCGTGGCGGTGCCGGCAACACCATCTTCCGCGACGACTGCAGCAATTCTATTCTGACTCGCAAGTAC
TCGGCTGGTAGTACGGCTACCAACTCCAGCACTGGCTCCGTGGCAGATCGGGCTCGTGACATGGCCCGTCGTGGT
CTCGAGAAGGGCTGGGGCAAGCTGAAGGGTACTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail