Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7576.t1
Gene name
Locationscaffold_24:208767..213503
Strand+
Gene length (bp)4736
Transcript length (bp)4539
Coding sequence length (bp)4539
Protein length (aa) 1513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 3.4E-54 698 970
PF15446 zf-PHD-like PHD/FYVE-zinc-finger like domain 6.7E-51 315 463
PF18585 zf-CCCH_6 Chromatin remodeling factor Mit1 C-terminal Zn finger 2 6.2E-24 1413 1465
PF00271 Helicase_C Helicase conserved C-terminal domain 6.5E-20 998 1108
PF11496 HDA2-3 Class II histone deacetylase complex subunits 2 and 3 3.3E-13 912 1134
PF04851 ResIII Type III restriction enzyme, res subunit 9.9E-05 679 844

GO

GO Term Description Terminal node
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0005524 ATP binding Yes
GO:0070823 HDA1 complex Yes
GO:0016787 hydrolase activity Yes
GO:0016575 histone deacetylation Yes
GO:0036211 protein modification process No
GO:0098732 macromolecule deacylation No
GO:0043170 macromolecule metabolic process No
GO:0003676 nucleic acid binding No
GO:0030554 adenyl nucleotide binding No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0140657 ATP-dependent activity No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0043167 ion binding No
GO:0006476 protein deacetylation No
GO:0032559 adenyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0140513 nuclear protein-containing complex No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1902494 catalytic complex No
GO:1901265 nucleoside phosphate binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0044238 primary metabolic process No
GO:0000118 histone deacetylase complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0016570 histone modification No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0035601 protein deacylation No
GO:0032991 protein-containing complex No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 6.54 3.43 9.65
5d_25C Five days - 25 degrees Celsius 5.55 2.79 8.32
7d_25C Seven days - 25 degrees Celsius 6.88 3.63 10.13
10d_25C Ten days - 25 degrees Celsius 5.34 2.64 8.03
7d_15C Seven days - 15 degrees Celsius 5.78 2.90 8.66
7d_30C Seven days - 30 degrees Celsius 6.51 3.35 9.66

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.627951 no
3d_25C 7d_25C 0.896170 no
3d_25C 7d_15C 0.734210 no
3d_25C 7d_30C 0.991203 no
3d_25C 10d_25C 0.524325 no
5d_25C 7d_25C 0.501684 no
5d_25C 7d_15C 0.929915 no
5d_25C 7d_30C 0.652006 no
5d_25C 10d_25C 0.929048 no
7d_25C 7d_15C 0.609307 no
7d_25C 7d_30C 0.891165 no
7d_25C 10d_25C 0.406113 no
7d_15C 7d_30C 0.748137 no
7d_15C 10d_25C 0.843099 no
7d_30C 10d_25C 0.546132 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7576.t1
MSQSRDNSPGSDSSDDADAVAAQLLAQFQSAPSCTPPTIPPEGPENALQPVQHITRNSKESTMSFEIIVPVVNNP
DDYEYLPGHFEVHRILAVDMHEPKLIVRLKSGEVQTMTTKDLKSLKNGRKALREFNRDSQSPDPLAMDHSPIPHF
IYAGGDGPADYDSDMDWGIARNRQRRAPLVSYNNFFRSDDEEDEDDYQSRREEIDSEESSDEDEDEDDPPTKRRQ
RRPPRRGAQRGRKQRDREWSEQSSASDTGKRVSSRLRQTRRRNMKERFEDDEYSAVEPEQPKHQKFSGAREQFRE
LPQDNKFRLCHSQSCTQCGHGDHDREKGSLVFCQGCTVSYHQGCLGDRTSRKHLVTKVDEGDFILQCSRCLGIKH
QEHDMKPHLGHCAVCRDEGPMSQPLRETLSSQTEQHLREANGGIDPITPVDMSSVNNVDNILIRCLGGSHSCKRA
FHIQHLPNTAEENLTHIDPDNWQCDECSKSPPGANPIQVIVAWKPRNPEVKVVSQLVEMIPEIDKLYLVKWHKLS
YFRVTWVTGDWVWARIPASQMKAFLKSERSTKPIMTVAEAVPEDNLRVDIVFDVEYHTEPKSQEDRANAKMVERA
YVKYKGLSYEDSVWEIPPEQTDTARWEDFQTALIDKVRQENVHVPKPKDLQSRLRDVRREKFDQSLLLTAQPALV
TGGELMDYQMEGVNWLLYMFFKQTNAILADDMGLGKTIQVITLFAALIDKLDCFPFLVVVPNATVPNWRREIKSW
SPHIRVVTYYGSAFAREMARDHEMFDENGTLCCHVVIASYESMADDGAKRVLSSINWAGLVVDEGQRLKNDKTQL
YERLRRMKFGFKLLLTGTPLQNNIRELFNLVQFIDPTYNAEELEAKYAGALDREAIRELHDMIRPCLLRRTKAEV
LPFLPPMVQIIIPVSMSVVQKKLYKSILQKNPQLLKAICKKQVGQLKKAERHNLNNILMQLRKCLCHPFIYNRDI
EEQTLDSQLSHRRLVEASGKLTLLNLMLPRLRERGHRVLIFSQFLENLDIVEDFLTGLGLQYCRLDGNLSSREKQ
QQIDQFNAPKSQFFAFLLSTRSGGVGINLATADTVIIMDPDFNPKQDMQALSRAHRIGQKNTVLVFHLVVRASVE
EKIMQKGKTKMALDHVLIDRIEADEDKEDLESILKHGAEALFNDDDSADITYDVDSIDKLLDRSQAEQVKKIASE
GSSDQNEQTQFNFARVWQKDRGSLEEVTETEDTPVDVTAWEKILQEREREAQEEANRQAEGLGRGKRKRGTPRYN
NNIVIEGVDDDENLSPRKPPSKMRKRAADNDDEFQQPEDDGDETEFESDHGAEPMDLTYDGAEPMDTANDGDRTE
AQMGTTNVVTPGLHVGAGQQVARAFRCVNSPPPVTYHLDIRPCVACKQRHIPGQCPLRSAGVEFCGLCGLAHWGG
RRICPHLQSRVQVSLMLDTLEESPEDPALILKAKKYLRGVLKSMGQTARSKASSATQAESRIFTSPSVSGVSRAP
TDLTGASTESKD*
Coding >Pro_DTO377G3_2|g7576.t1
ATGTCTCAATCTAGAGACAATTCTCCAGGCTCTGATAGCTCTGATGATGCTGATGCTGTGGCTGCACAATTGCTA
GCACAGTTCCAGAGCGCTCCCTCTTGTACTCCTCCCACCATCCCACCTGAGGGTCCTGAAAATGCCCTCCAGCCA
GTGCAACATATCACTAGAAACTCAAAAGAATCAACAATGTCTTTTGAGATCATCGTCCCAGTGGTTAACAACCCT
GATGACTATGAGTATTTGCCCGGTCACTTTGAGGTTCATCGCATTCTTGCAGTCGACATGCATGAGCCAAAGCTC
ATTGTGAGACTCAAAAGTGGTGAAGTTCAAACTATGACCACCAAAGATTTGAAAAGCCTCAAGAACGGACGAAAG
GCTTTGCGTGAATTCAACCGTGACTCACAGAGCCCTGACCCCCTCGCAATGGACCACTCCCCCATCCCACATTTC
ATTTACGCGGGTGGAGATGGTCCTGCGGACTATGATTCAGATATGGACTGGGGAATTGCACGAAACCGCCAACGA
CGCGCGCCGTTGGTCTCATACAACAATTTCTTCCGCAGTGATGATGAAGAAGATGAAGACGACTATCAAAGCCGC
CGTGAAGAGATTGACTCAGAGGAGTCCAGTGATGAGGATGAAGATGAAGATGATCCTCCAACCAAACGCCGCCAA
CGCCGCCCTCCGAGAAGGGGTGCGCAGAGGGGCCGAAAGCAACGTGATCGCGAATGGTCTGAACAGTCTTCTGCC
TCTGATACAGGCAAACGAGTATCATCTCGCCTGCGACAGACCCGTCGACGCAATATGAAAGAACGCTTCGAAGAC
GACGAATATTCTGCGGTTGAACCTGAGCAGCCTAAGCACCAAAAGTTCTCGGGTGCGAGGGAGCAGTTCCGTGAA
CTACCACAGGACAATAAATTCAGATTGTGCCACTCCCAGTCATGCACCCAATGCGGCCATGGAGATCATGACCGT
GAAAAGGGGTCTTTGGTCTTCTGCCAAGGTTGTACCGTGTCATACCATCAAGGTTGTCTTGGCGATCGAACCAGC
CGAAAGCACTTGGTCACCAAGGTTGACGAAGGGGATTTCATTCTTCAATGCAGTCGGTGTTTGGGGATCAAGCAC
CAAGAGCATGACATGAAGCCTCATTTAGGCCATTGTGCCGTGTGTAGAGACGAAGGACCCATGTCGCAGCCGTTG
CGAGAGACTCTTTCTTCCCAGACTGAGCAGCACTTGCGGGAAGCCAATGGTGGCATAGATCCGATTACTCCCGTG
GATATGTCCAGTGTCAACAATGTCGATAATATCCTCATCAGATGCCTTGGTGGCAGCCATAGCTGCAAGCGAGCC
TTCCATATTCAGCATCTACCAAACACGGCAGAGGAGAACCTTACCCACATTGATCCTGATAACTGGCAATGCGAC
GAATGCTCTAAATCACCTCCTGGTGCCAATCCAATCCAGGTGATCGTTGCTTGGAAACCAAGGAATCCCGAAGTC
AAAGTCGTCTCGCAGTTGGTTGAGATGATCCCAGAGATCGACAAACTATATCTCGTCAAGTGGCACAAGCTGTCC
TACTTCCGTGTTACCTGGGTGACTGGAGACTGGGTCTGGGCCAGGATTCCTGCCAGCCAGATGAAGGCGTTTCTC
AAGTCAGAAAGATCCACCAAACCGATTATGACAGTAGCTGAGGCTGTCCCCGAAGACAATCTGCGAGTGGACATT
GTTTTTGATGTGGAATATCACACCGAGCCTAAATCCCAGGAGGATCGAGCAAACGCCAAGATGGTCGAACGGGCA
TACGTCAAGTACAAAGGGTTGTCATACGAAGACTCAGTCTGGGAAATTCCCCCAGAACAGACTGACACAGCTCGT
TGGGAGGATTTCCAGACCGCTCTTATCGACAAAGTACGCCAAGAGAATGTCCACGTCCCGAAGCCGAAAGATCTT
CAAAGCCGTCTCAGAGATGTCCGTAGAGAGAAGTTTGACCAGAGCCTTCTTCTGACTGCTCAGCCTGCGTTGGTG
ACCGGTGGTGAGCTCATGGATTATCAGATGGAAGGCGTGAATTGGCTGCTGTACATGTTCTTCAAGCAAACCAAC
GCCATTCTTGCTGACGATATGGGCCTCGGAAAGACAATCCAGGTCATCACCCTATTCGCGGCATTGATCGATAAG
CTAGACTGTTTTCCATTCTTGGTCGTTGTTCCAAATGCGACTGTGCCAAACTGGCGCCGAGAGATCAAGAGCTGG
TCGCCACACATCCGGGTTGTCACCTATTATGGGAGTGCCTTCGCTCGCGAGATGGCCAGGGACCATGAGATGTTT
GACGAGAATGGCACTCTATGTTGCCATGTGGTTATTGCTTCGTATGAGAGCATGGCAGACGATGGGGCTAAGCGA
GTCTTGTCCAGTATCAATTGGGCTGGCTTGGTGGTTGATGAAGGTCAGCGCCTCAAGAATGACAAGACCCAGCTC
TATGAGCGTCTTCGTCGCATGAAATTCGGTTTCAAGTTGCTGCTCACTGGTACACCGCTTCAAAATAATATCAGA
GAGCTCTTCAACTTGGTTCAGTTCATCGACCCAACTTACAATGCGGAGGAGTTGGAGGCCAAATACGCAGGAGCC
CTCGACAGGGAAGCGATTCGCGAGCTCCACGACATGATTCGGCCATGTCTCCTGCGTCGAACAAAGGCAGAGGTT
CTGCCGTTCCTACCCCCGATGGTGCAAATCATCATTCCAGTTTCGATGTCTGTTGTGCAGAAGAAGCTGTACAAA
TCGATCCTTCAAAAGAACCCGCAGCTTCTCAAGGCTATTTGCAAGAAGCAAGTCGGGCAGTTGAAGAAAGCAGAG
CGCCATAATTTGAACAATATCCTAATGCAGCTGCGCAAATGTCTTTGTCACCCGTTCATTTATAACCGGGACATC
GAAGAGCAGACTCTGGACTCTCAGCTTTCCCATCGGCGTTTGGTCGAAGCATCCGGGAAGCTTACGTTGCTGAAC
TTGATGTTACCGCGACTTCGAGAGCGTGGACACCGCGTCCTCATCTTCAGTCAATTTTTAGAGAACCTCGACATT
GTTGAAGACTTCCTCACTGGACTGGGACTCCAGTACTGTCGCCTGGATGGAAACTTATCCTCGAGGGAAAAACAG
CAACAGATCGACCAGTTTAACGCGCCGAAATCCCAATTCTTTGCCTTTTTGCTTTCGACGCGGTCCGGTGGTGTC
GGAATTAACCTCGCCACTGCCGATACGGTCATCATCATGGATCCGGATTTCAATCCAAAACAAGACATGCAGGCT
CTGTCGCGTGCTCATCGAATCGGGCAAAAGAATACAGTCCTTGTTTTCCACCTGGTAGTGCGCGCGTCAGTGGAG
GAAAAAATCATGCAGAAAGGTAAAACCAAGATGGCACTCGATCACGTACTTATCGATCGCATCGAGGCCGATGAA
GATAAAGAAGACTTAGAGTCCATCCTCAAGCATGGTGCGGAGGCACTGTTCAATGACGATGACTCGGCAGACATT
ACTTACGATGTGGACTCCATTGACAAGCTGTTGGACCGTAGCCAGGCTGAGCAGGTCAAGAAAATTGCCAGCGAG
GGAAGTTCGGACCAGAATGAGCAGACGCAGTTCAATTTCGCCCGGGTGTGGCAAAAGGATCGAGGTAGCCTTGAA
GAAGTGACTGAGACTGAGGACACGCCTGTGGATGTTACGGCGTGGGAGAAGATTCTGCAGGAGCGTGAGCGTGAA
GCGCAGGAGGAAGCTAACCGTCAAGCTGAAGGTCTTGGGCGCGGTAAAAGAAAGCGCGGCACACCCCGCTACAAT
AACAATATTGTTATCGAAGGAGTTGACGACGATGAGAATCTTAGCCCCCGAAAGCCGCCTAGCAAGATGCGAAAG
CGTGCAGCTGACAATGACGATGAGTTCCAACAGCCAGAGGATGATGGTGATGAGACCGAGTTCGAGTCCGATCAC
GGCGCTGAGCCAATGGACCTTACATACGATGGAGCTGAGCCAATGGACACCGCAAATGACGGCGACAGGACTGAG
GCACAAATGGGCACTACAAATGTTGTCACACCTGGTCTTCATGTAGGTGCAGGACAGCAAGTCGCACGCGCGTTC
CGTTGTGTTAATTCCCCGCCCCCAGTGACCTACCACCTTGATATCCGTCCTTGTGTGGCGTGCAAACAACGCCAC
ATCCCTGGGCAGTGCCCACTCCGTTCGGCTGGTGTCGAGTTCTGTGGCCTCTGCGGCCTGGCGCACTGGGGTGGC
CGCCGGATCTGCCCCCACCTGCAGTCACGGGTGCAGGTCAGCCTTATGCTGGATACGCTGGAAGAGAGCCCGGAG
GACCCGGCCCTCATCCTTAAGGCGAAAAAATACCTTCGGGGTGTTCTCAAATCAATGGGGCAGACTGCCCGGAGC
AAGGCTTCGTCTGCCACTCAGGCGGAGTCTCGGATTTTCACCTCGCCCTCAGTTAGCGGGGTGAGCCGTGCCCCT
ACCGATTTAACAGGGGCAAGTACTGAGTCGAAAGACTAA
Transcript >Pro_DTO377G3_2|g7576.t1
ATGTCTCAATCTAGAGACAATTCTCCAGGCTCTGATAGCTCTGATGATGCTGATGCTGTGGCTGCACAATTGCTA
GCACAGTTCCAGAGCGCTCCCTCTTGTACTCCTCCCACCATCCCACCTGAGGGTCCTGAAAATGCCCTCCAGCCA
GTGCAACATATCACTAGAAACTCAAAAGAATCAACAATGTCTTTTGAGATCATCGTCCCAGTGGTTAACAACCCT
GATGACTATGAGTATTTGCCCGGTCACTTTGAGGTTCATCGCATTCTTGCAGTCGACATGCATGAGCCAAAGCTC
ATTGTGAGACTCAAAAGTGGTGAAGTTCAAACTATGACCACCAAAGATTTGAAAAGCCTCAAGAACGGACGAAAG
GCTTTGCGTGAATTCAACCGTGACTCACAGAGCCCTGACCCCCTCGCAATGGACCACTCCCCCATCCCACATTTC
ATTTACGCGGGTGGAGATGGTCCTGCGGACTATGATTCAGATATGGACTGGGGAATTGCACGAAACCGCCAACGA
CGCGCGCCGTTGGTCTCATACAACAATTTCTTCCGCAGTGATGATGAAGAAGATGAAGACGACTATCAAAGCCGC
CGTGAAGAGATTGACTCAGAGGAGTCCAGTGATGAGGATGAAGATGAAGATGATCCTCCAACCAAACGCCGCCAA
CGCCGCCCTCCGAGAAGGGGTGCGCAGAGGGGCCGAAAGCAACGTGATCGCGAATGGTCTGAACAGTCTTCTGCC
TCTGATACAGGCAAACGAGTATCATCTCGCCTGCGACAGACCCGTCGACGCAATATGAAAGAACGCTTCGAAGAC
GACGAATATTCTGCGGTTGAACCTGAGCAGCCTAAGCACCAAAAGTTCTCGGGTGCGAGGGAGCAGTTCCGTGAA
CTACCACAGGACAATAAATTCAGATTGTGCCACTCCCAGTCATGCACCCAATGCGGCCATGGAGATCATGACCGT
GAAAAGGGGTCTTTGGTCTTCTGCCAAGGTTGTACCGTGTCATACCATCAAGGTTGTCTTGGCGATCGAACCAGC
CGAAAGCACTTGGTCACCAAGGTTGACGAAGGGGATTTCATTCTTCAATGCAGTCGGTGTTTGGGGATCAAGCAC
CAAGAGCATGACATGAAGCCTCATTTAGGCCATTGTGCCGTGTGTAGAGACGAAGGACCCATGTCGCAGCCGTTG
CGAGAGACTCTTTCTTCCCAGACTGAGCAGCACTTGCGGGAAGCCAATGGTGGCATAGATCCGATTACTCCCGTG
GATATGTCCAGTGTCAACAATGTCGATAATATCCTCATCAGATGCCTTGGTGGCAGCCATAGCTGCAAGCGAGCC
TTCCATATTCAGCATCTACCAAACACGGCAGAGGAGAACCTTACCCACATTGATCCTGATAACTGGCAATGCGAC
GAATGCTCTAAATCACCTCCTGGTGCCAATCCAATCCAGGTGATCGTTGCTTGGAAACCAAGGAATCCCGAAGTC
AAAGTCGTCTCGCAGTTGGTTGAGATGATCCCAGAGATCGACAAACTATATCTCGTCAAGTGGCACAAGCTGTCC
TACTTCCGTGTTACCTGGGTGACTGGAGACTGGGTCTGGGCCAGGATTCCTGCCAGCCAGATGAAGGCGTTTCTC
AAGTCAGAAAGATCCACCAAACCGATTATGACAGTAGCTGAGGCTGTCCCCGAAGACAATCTGCGAGTGGACATT
GTTTTTGATGTGGAATATCACACCGAGCCTAAATCCCAGGAGGATCGAGCAAACGCCAAGATGGTCGAACGGGCA
TACGTCAAGTACAAAGGGTTGTCATACGAAGACTCAGTCTGGGAAATTCCCCCAGAACAGACTGACACAGCTCGT
TGGGAGGATTTCCAGACCGCTCTTATCGACAAAGTACGCCAAGAGAATGTCCACGTCCCGAAGCCGAAAGATCTT
CAAAGCCGTCTCAGAGATGTCCGTAGAGAGAAGTTTGACCAGAGCCTTCTTCTGACTGCTCAGCCTGCGTTGGTG
ACCGGTGGTGAGCTCATGGATTATCAGATGGAAGGCGTGAATTGGCTGCTGTACATGTTCTTCAAGCAAACCAAC
GCCATTCTTGCTGACGATATGGGCCTCGGAAAGACAATCCAGGTCATCACCCTATTCGCGGCATTGATCGATAAG
CTAGACTGTTTTCCATTCTTGGTCGTTGTTCCAAATGCGACTGTGCCAAACTGGCGCCGAGAGATCAAGAGCTGG
TCGCCACACATCCGGGTTGTCACCTATTATGGGAGTGCCTTCGCTCGCGAGATGGCCAGGGACCATGAGATGTTT
GACGAGAATGGCACTCTATGTTGCCATGTGGTTATTGCTTCGTATGAGAGCATGGCAGACGATGGGGCTAAGCGA
GTCTTGTCCAGTATCAATTGGGCTGGCTTGGTGGTTGATGAAGGTCAGCGCCTCAAGAATGACAAGACCCAGCTC
TATGAGCGTCTTCGTCGCATGAAATTCGGTTTCAAGTTGCTGCTCACTGGTACACCGCTTCAAAATAATATCAGA
GAGCTCTTCAACTTGGTTCAGTTCATCGACCCAACTTACAATGCGGAGGAGTTGGAGGCCAAATACGCAGGAGCC
CTCGACAGGGAAGCGATTCGCGAGCTCCACGACATGATTCGGCCATGTCTCCTGCGTCGAACAAAGGCAGAGGTT
CTGCCGTTCCTACCCCCGATGGTGCAAATCATCATTCCAGTTTCGATGTCTGTTGTGCAGAAGAAGCTGTACAAA
TCGATCCTTCAAAAGAACCCGCAGCTTCTCAAGGCTATTTGCAAGAAGCAAGTCGGGCAGTTGAAGAAAGCAGAG
CGCCATAATTTGAACAATATCCTAATGCAGCTGCGCAAATGTCTTTGTCACCCGTTCATTTATAACCGGGACATC
GAAGAGCAGACTCTGGACTCTCAGCTTTCCCATCGGCGTTTGGTCGAAGCATCCGGGAAGCTTACGTTGCTGAAC
TTGATGTTACCGCGACTTCGAGAGCGTGGACACCGCGTCCTCATCTTCAGTCAATTTTTAGAGAACCTCGACATT
GTTGAAGACTTCCTCACTGGACTGGGACTCCAGTACTGTCGCCTGGATGGAAACTTATCCTCGAGGGAAAAACAG
CAACAGATCGACCAGTTTAACGCGCCGAAATCCCAATTCTTTGCCTTTTTGCTTTCGACGCGGTCCGGTGGTGTC
GGAATTAACCTCGCCACTGCCGATACGGTCATCATCATGGATCCGGATTTCAATCCAAAACAAGACATGCAGGCT
CTGTCGCGTGCTCATCGAATCGGGCAAAAGAATACAGTCCTTGTTTTCCACCTGGTAGTGCGCGCGTCAGTGGAG
GAAAAAATCATGCAGAAAGGTAAAACCAAGATGGCACTCGATCACGTACTTATCGATCGCATCGAGGCCGATGAA
GATAAAGAAGACTTAGAGTCCATCCTCAAGCATGGTGCGGAGGCACTGTTCAATGACGATGACTCGGCAGACATT
ACTTACGATGTGGACTCCATTGACAAGCTGTTGGACCGTAGCCAGGCTGAGCAGGTCAAGAAAATTGCCAGCGAG
GGAAGTTCGGACCAGAATGAGCAGACGCAGTTCAATTTCGCCCGGGTGTGGCAAAAGGATCGAGGTAGCCTTGAA
GAAGTGACTGAGACTGAGGACACGCCTGTGGATGTTACGGCGTGGGAGAAGATTCTGCAGGAGCGTGAGCGTGAA
GCGCAGGAGGAAGCTAACCGTCAAGCTGAAGGTCTTGGGCGCGGTAAAAGAAAGCGCGGCACACCCCGCTACAAT
AACAATATTGTTATCGAAGGAGTTGACGACGATGAGAATCTTAGCCCCCGAAAGCCGCCTAGCAAGATGCGAAAG
CGTGCAGCTGACAATGACGATGAGTTCCAACAGCCAGAGGATGATGGTGATGAGACCGAGTTCGAGTCCGATCAC
GGCGCTGAGCCAATGGACCTTACATACGATGGAGCTGAGCCAATGGACACCGCAAATGACGGCGACAGGACTGAG
GCACAAATGGGCACTACAAATGTTGTCACACCTGGTCTTCATGTAGGTGCAGGACAGCAAGTCGCACGCGCGTTC
CGTTGTGTTAATTCCCCGCCCCCAGTGACCTACCACCTTGATATCCGTCCTTGTGTGGCGTGCAAACAACGCCAC
ATCCCTGGGCAGTGCCCACTCCGTTCGGCTGGTGTCGAGTTCTGTGGCCTCTGCGGCCTGGCGCACTGGGGTGGC
CGCCGGATCTGCCCCCACCTGCAGTCACGGGTGCAGGTCAGCCTTATGCTGGATACGCTGGAAGAGAGCCCGGAG
GACCCGGCCCTCATCCTTAAGGCGAAAAAATACCTTCGGGGTGTTCTCAAATCAATGGGGCAGACTGCCCGGAGC
AAGGCTTCGTCTGCCACTCAGGCGGAGTCTCGGATTTTCACCTCGCCCTCAGTTAGCGGGGTGAGCCGTGCCCCT
ACCGATTTAACAGGGGCAAGTACTGAGTCGAAAGACTAA
Gene >Pro_DTO377G3_2|g7576.t1
ATGTCTCAATCTAGAGACAATTCTCCAGGCTCTGATAGCTCTGATGATGCTGATGCTGTGGCTGCACAATTGCTA
GCACAGTTCCAGAGCGCTCCCTCTTGTACTCCTCCCACCATCCCACCTGAGGGTCCTGAAAATGCCCTCCAGCCA
GTGCAACATATCACTAGAAACTCAAAAGAATCAACAATGTCTTTTGAGATCATCGTCCCAGTGGTTAACAACCCT
GATGACTATGAGTATTTGCCCGGTCACTTTGAGGTTCATCGCATTCTTGCAGTCGACATGCATGAGCCAAAGCTC
ATTGTGAGACTCAAAAGTGGTGAAGTTCAAACTGTAAGCGAACACAAGTAATCAATCAATCTTAGGCGCCGTTCA
ACTGACCATGACTTTCACTAGATGACCACCAAAGATTTGAAAAGCCTCAAGAACGGACGAAAGGCTTTGCGTGAA
TTCAACCGTGACTCACAGAGCCCTGACCCCCTCGCAATGGACCACTCCCCCATCCCACATTTCATTTACGCGGGT
GGAGATGGTCCTGCGGACTATGATTCAGATATGGACTGGGGAATTGCACGAAACCGCCAACGACGCGCGCCGTTG
GTCTCATACAACAATTTCTTCCGCAGTGATGATGAAGAAGATGAAGACGACTATCAAAGCCGCCGTGAAGAGATT
GACTCAGAGGAGTCCAGTGATGAGGATGAAGATGAAGATGATCCTCCAACCAAACGCCGCCAACGCCGCCCTCCG
AGAAGGGGTGCGCAGAGGGGCCGAAAGCAACGTGATCGCGAATGGTCTGAACAGTCTTCTGCCTCTGATACAGGC
AAACGAGTATCATCTCGCCTGCGACAGACCCGTCGACGCAATATGAAAGAACGCTTCGAAGACGACGAATATTCT
GCGGTTGAACCTGAGCAGCCTAAGCACCAAAAGTTCTCGGGTGCGAGGGAGCAGTTCCGTGAACTACCACAGGAC
AATAAATTCAGATTGTGCCACTCCCAGTCATGCACCCAATGCGGCCATGGAGATCATGACCGTGAAAAGGGGTCT
TTGGTCTTCTGCCAAGGTTGTACCGTGTCATACCATCAAGGTTGTCTTGGCGATCGAACCAGCCGAAAGCACTTG
GTCACCAAGGTTGACGAAGGGGATTTCATTCTTCAATGCAGTCGGTGTTTGGGGATCAAGCACCAAGAGCATGAC
ATGAAGCCTCATTTAGGCCATTGTGCCGTGTGTAGAGACGAAGGACCCATGTCGCAGCCGTTGCGAGAGACTCTT
TCTTCCCAGACTGAGCAGCACTTGCGGGAAGCCAATGGTGGCATAGATCCGATTACTCCCGTGGATATGTCCAGT
GTCAACAATGTCGATAATATCCTCATCAGATGCCTTGGTGGCAGCCATAGCTGCAAGCGAGCCTTCCATATTCAG
CATCTACCAAACACGGCAGAGGAGAACCTTACCCACATTGATCCTGATAACTGGCAATGCGACGAATGCTCTAAA
TCACCTCCTGGTGCCAATCCAATCCAGGTGATCGTTGCTTGGAAACCAAGGAATCCCGAAGTCAAAGTCGTCTCG
CAGTTGGTTGAGATGATCCCAGAGATCGACAAACTATATCTCGTCAAGTGGCACAAGCTGTCCTACTTCCGTGTT
ACCTGGGTGACTGGAGACTGGGTCTGGGCCAGGATTCCTGCCAGCCAGATGAAGGCGTTTCTCAAGTCAGAAAGA
TCCACCAAACCGATTATGACAGTAGCTGAGGCTGTCCCCGAAGACAATCTGCGAGTGGACATTGTTTTTGATGTG
GAATATCACACCGAGCCTAAATCCCAGGAGGATCGAGCAAACGCCAAGATGGTCGAACGGGCATACGTCAAGTAC
AAAGGGTTGTCATACGAAGACTCAGTCTGGGAAATTCCCCCAGAACAGACTGACACAGCTCGTTGGGAGGATTTC
CAGACCGCTCTTATCGACAAAGTACGCCAAGAGAATGTCCACGTCCCGAAGCCGAAAGATCTTCAAAGCCGTCTC
AGAGATGTCCGTAGAGAGAAGTTTGACCAGAGCCTTCTTCTGACTGCTCAGCCTGCGTTGGTGACCGGTGGTGAG
CTCATGGATTATCAGATGGAAGGCGTGAATTGGCTGCTGTACATGTTCTTCAAGCAAACCAACGCCATTCTTGCT
GACGATATGGGCCTCGGAAAGACAATCCAGGTCATCACCCTATTCGCGGCATTGATCGATAAGCTAGACTGTTTT
CCATTCTTGGTCGTTGTTCCAAATGCGACTGTGCCAAACTGGCGCCGAGAGATCAAGAGCTGGTCGCCACACATC
CGGGTTGTCACCTATTATGGGAGTGCCTTCGCTCGCGAGATGGCCAGGGACCATGAGATGTTTGACGAGAATGGC
ACTCTATGTTGCCATGTGGTTATTGCTTCGTATGAGAGCATGGCAGACGATGGGGCTAAGCGAGTCTTGTCCAGT
ATCAATTGGGCTGGCTTGGTGGTTGATGAAGGTCAGCGCCTCAAGAATGACAAGACCCAGCTCTATGAGCGTCTT
CGTCGCATGAAATTCGGTTTCAAGTTGCTGCTCACTGGTACACCGCTTCAAAATAATATCAGAGAGCTCTTCAAC
TTGGTTCAGTTCATCGACCCAACTTACAATGCGGAGGAGTTGGAGGCCAAATACGCAGGAGCCCTCGACAGGGAA
GCGATTCGCGAGCTCCACGACATGATTCGGCCATGTCTCCTGCGTCGAACAAAGGCAGAGGTTCTGCCGTTCCTA
CCCCCGATGGTGCAAATCATCATTCCAGTTTCGATGTCTGTTGTGCAGAAGAAGCTGTACAAATCGATCCTTCAA
AAGAACCCGCAGCTTCTCAAGGCTATTTGCAAGAAGCAAGTCGGGCAGTTGAAGAAAGCAGAGCGCCATAATTTG
AACAATATCCTAATGCAGCTGCGCAAATGTCTTTGTCACCCGTTCATTTATAACCGGGACATCGAAGAGCAGACT
CTGGACTCTCAGCTTTCCCATCGGCGTTTGGTCGAAGCATCCGGGAAGCTTACGTTGCTGAACTTGATGTTACCG
CGACTTCGAGAGCGTGGACACCGCGTCCTCATCTTCAGTCAATTTTTAGAGAACCTCGACATTGTTGAAGACTTC
CTCACTGGACTGGGACTCCAGTACTGTCGCCTGGATGGAAACTTATCCTCGAGGGAAAAACAGCAACAGATCGAC
CAGTTTAACGCGCCGAAATCCCAATTCTTTGCCTTTTTGCTTTCGACGCGGTCCGGTGGTGTCGGAATTAACCTC
GCCACTGCCGATACGGTCATCATCATGGATCCGGATTTCAATCCAAAACAAGACATGCAGGCTCTGTCGCGTGCT
CATCGAATCGGGCAAAAGAATACAGTCCTTGTTTTCCACCTGGTAGTGCGCGCGTCAGTGGAGGAAAAAATCATG
CAGAAAGGTAAAACCAAGATGGCACTCGATCACGTACTTATCGATCGCATCGAGGCCGATGAAGATAAAGAAGAC
TTAGAGTCCATCCTCAAGCATGGTGCGGAGGCACTGTTCAATGACGATGACTCGGCAGACATTACTTACGATGTG
GACTCCATTGACAAGCTGTTGGACCGTAGCCAGGCTGAGCAGGTCAAGAAAATTGCCAGCGAGGGAAGTTCGGAC
CAGAATGAGCAGACGCAGTTCAATTTCGCCCGGGTGTGGCAAAAGGATCGAGGTAGCCTTGAAGAAGTGACTGAG
ACTGAGGACACGCCTGTGGATGTTACGGCGTGGGAGAAGATTCTGCAGGAGCGTGAGCGTGAAGCGCAGGAGGAA
GCTAACCGTCAAGCTGAAGGTCTTGGGCGCGGTAAAAGAAAGCGCGGCACACCCCGCTACAATAACAATATTGTT
ATCGAAGGAGTTGACGACGATGAGAATCTTAGCCCCCGAAAGCCGCCTAGCAAGATGCGAAAGCGTGCAGCTGAC
AATGACGATGAGTTCCAACAGCCAGAGGATGATGGTGATGAGACCGAGTTCGAGTCCGATCACGGCGCTGAGCCA
ATGGACCTTACATACGATGGAGCTGAGCCAATGGACACCGCAAATGACGGCGACAGGACTGAGGCACAAATGGGC
ACTACAAATGTTGTCACACCTGGTCTTCATGTAGGTGCAGGACAGCAAGGTGAGATCTAATCCATATTCCATGCG
TATCCTAGTTATTGCTTTTTTTTGTTTTTTTTTTTTTTTGATTTTAATACCCTATCATTCCGTATTGCCGTGTAA
AGACACAGTTCGTTAACTGTACATGATTCTCAGTCGCACGCGCGTTCCGTTGTGTTAATTCCCCGCCCCCAGTGA
CCTACCACCTTGATATCCGTCCTTGTGTGGCGTGCAAACAACGCCACATCCCTGGGCAGTGCCCACTCCGTTCGG
CTGGTGTCGAGTTCTGTGGCCTCTGCGGCCTGGCGCACTGGGGTGGCCGCCGGATCTGCCCCCACCTGCAGTCAC
GGGTGCAGGTCAGCCTTATGCTGGATACGCTGGAAGAGAGCCCGGAGGACCCGGCCCTCATCCTTAAGGCGAAAA
AATACCTTCGGGGTGTTCTCAAATCAATGGGGCAGACTGCCCGGAGCAAGGCTTCGTCTGCCACTCAGGCGGAGT
CTCGGATTTTCACCTCGCCCTCAGTTAGCGGGGTGAGCCGTGCCCCTACCGATTTAACAGGGGCAAGTACTGAGT
CGAAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail