Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7576.t1
Gene name
Locationscaffold_24:208767..213503
Strand+
Gene length (bp)4736
Transcript length (bp)4539
Coding sequence length (bp)4539
Protein length (aa) 1513

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2_N SNF2 family N-terminal domain 4.8E-51 699 970
PF15446 zf-PHD-like PHD/FYVE-zinc-finger like domain 3.8E-50 315 463
PF18585 zf-CCCH_6 Chromatin remodeling factor Mit1 C-terminal Zn finger 2 5.5E-24 1413 1465
PF00271 Helicase_C Helicase conserved C-terminal domain 5.6E-20 998 1108
PF11496 HDA2-3 Class II histone deacetylase complex subunits 2 and 3 3.0E-13 912 1134
PF04851 ResIII Type III restriction enzyme, res subunit 9.0E-05 679 844

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016575 histone deacetylation Yes
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0070823 HDA1 complex Yes
GO:0036211 protein modification process No
GO:0003824 catalytic activity No
GO:0044427 chromosomal part No
GO:0000118 histone deacetylase complex No
GO:0032559 adenyl ribonucleotide binding No
GO:0044238 primary metabolic process No
GO:0043168 anion binding No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0008152 metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0016570 histone modification No
GO:0032553 ribonucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044446 intracellular organelle part No
GO:0044464 cell part No
GO:0097159 organic cyclic compound binding No
GO:0016569 covalent chromatin modification No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0006464 cellular protein modification process No
GO:0016043 cellular component organization No
GO:0006325 chromatin organization No
GO:1901564 organonitrogen compound metabolic process No
GO:0044451 nucleoplasm part No
GO:0071840 cellular component organization or biogenesis No
GO:0036094 small molecule binding No
GO:0098732 macromolecule deacylation No
GO:0035601 protein deacylation No
GO:0006476 protein deacetylation No
GO:0044237 cellular metabolic process No
GO:1902494 catalytic complex No
GO:0019538 protein metabolic process No
GO:0005488 binding No
GO:0044424 intracellular part No
GO:0003676 nucleic acid binding No
GO:0044422 organelle part No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0044454 nuclear chromosome part No
GO:0043412 macromolecule modification No
GO:0044428 nuclear part No
GO:0043167 ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0008144 drug binding No
GO:0044267 cellular protein metabolic process No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7576.t1
MSQSRDNSPGSDSSDDADAVAAQLLAQFQSAPSCTPPTIPPEGPENALQPVQHITRNSKESTMSFEIIVPVVNNP
DDYEYLPGHFEVHRILAVDMHEPKLIVRLKSGEVQTMTTKDLKSLKNGRKALREFNRDSQSPDPLAMDHSPIPHF
IYAGGDGPADYDSDMDWGIARNRQRRAPLVSYNNFFRSDDEEDEDDYQSRREEIDSEESSDEDEDEDDPPTKRRQ
RRPPRRGAQRGRKQRDREWSEQSSASDTGKRVSSRLRQTRRRNMKERFEDDEYSAVEPEQPKHQKFSGAREQFRE
LPQDNKFRLCHSQSCTQCGHGDHDREKGSLVFCQGCTVSYHQGCLGDRTSRKHLVTKVDEGDFILQCSRCLGIKH
QEHDMKPHLGHCAVCRDEGPMSQPLRETLSSQTEQHLREANGGIDPITPVDMSSVNNVDNILIRCLGGSHSCKRA
FHIQHLPNTAEENLTHIDPDNWQCDECSKSPPGANPIQVIVAWKPRNPEVKVVSQLVEMIPEIDKLYLVKWHKLS
YFRVTWVTGDWVWARIPASQMKAFLKSERSTKPIMTVAEAVPEDNLRVDIVFDVEYHTEPKSQEDRANAKMVERA
YVKYKGLSYEDSVWEIPPEQTDTARWEDFQTALIDKVRQENVHVPKPKDLQSRLRDVRREKFDQSLLLTAQPALV
TGGELMDYQMEGVNWLLYMFFKQTNAILADDMGLGKTIQVITLFAALIDKLDCFPFLVVVPNATVPNWRREIKSW
SPHIRVVTYYGSAFAREMARDHEMFDENGTLCCHVVIASYESMADDGAKRVLSSINWAGLVVDEGQRLKNDKTQL
YERLRRMKFGFKLLLTGTPLQNNIRELFNLVQFIDPTYNAEELEAKYAGALDREAIRELHDMIRPCLLRRTKAEV
LPFLPPMVQIIIPVSMSVVQKKLYKSILQKNPQLLKAICKKQVGQLKKAERHNLNNILMQLRKCLCHPFIYNRDI
EEQTLDSQLSHRRLVEASGKLTLLNLMLPRLRERGHRVLIFSQFLENLDIVEDFLTGLGLQYCRLDGNLSSREKQ
QQIDQFNAPKSQFFAFLLSTRSGGVGINLATADTVIIMDPDFNPKQDMQALSRAHRIGQKNTVLVFHLVVRASVE
EKIMQKGKTKMALDHVLIDRIEADEDKEDLESILKHGAEALFNDDDSADITYDVDSIDKLLDRSQAEQVKKIASE
GSSDQNEQTQFNFARVWQKDRGSLEEVTETEDTPVDVTAWEKILQEREREAQEEANRQAEGLGRGKRKRGTPRYN
NNIVIEGVDDDENLSPRKPPSKMRKRAADNDDEFQQPEDDGDETEFESDHGAEPMDLTYDGAEPMDTANDGDRTE
AQMGTTNVVTPGLHVGAGQQVARAFRCVNSPPPVTYHLDIRPCVACKQRHIPGQCPLRSAGVEFCGLCGLAHWGG
RRICPHLQSRVQVSLMLDTLEESPEDPALILKAKKYLRGVLKSMGQTARSKASSATQAESRIFTSPSVSGVSRAP
TDLTGASTESKD*
Coding >Pro_DTO377G3_2|g7576.t1
ATGTCTCAATCTAGAGACAATTCTCCAGGCTCTGATAGCTCTGATGATGCTGATGCTGTGGCTGCACAATTGCTA
GCACAGTTCCAGAGCGCTCCCTCTTGTACTCCTCCCACCATCCCACCTGAGGGTCCTGAAAATGCCCTCCAGCCA
GTGCAACATATCACTAGAAACTCAAAAGAATCAACAATGTCTTTTGAGATCATCGTCCCAGTGGTTAACAACCCT
GATGACTATGAGTATTTGCCCGGTCACTTTGAGGTTCATCGCATTCTTGCAGTCGACATGCATGAGCCAAAGCTC
ATTGTGAGACTCAAAAGTGGTGAAGTTCAAACTATGACCACCAAAGATTTGAAAAGCCTCAAGAACGGACGAAAG
GCTTTGCGTGAATTCAACCGTGACTCACAGAGCCCTGACCCCCTCGCAATGGACCACTCCCCCATCCCACATTTC
ATTTACGCGGGTGGAGATGGTCCTGCGGACTATGATTCAGATATGGACTGGGGAATTGCACGAAACCGCCAACGA
CGCGCGCCGTTGGTCTCATACAACAATTTCTTCCGCAGTGATGATGAAGAAGATGAAGACGACTATCAAAGCCGC
CGTGAAGAGATTGACTCAGAGGAGTCCAGTGATGAGGATGAAGATGAAGATGATCCTCCAACCAAACGCCGCCAA
CGCCGCCCTCCGAGAAGGGGTGCGCAGAGGGGCCGAAAGCAACGTGATCGCGAATGGTCTGAACAGTCTTCTGCC
TCTGATACAGGCAAACGAGTATCATCTCGCCTGCGACAGACCCGTCGACGCAATATGAAAGAACGCTTCGAAGAC
GACGAATATTCTGCGGTTGAACCTGAGCAGCCTAAGCACCAAAAGTTCTCGGGTGCGAGGGAGCAGTTCCGTGAA
CTACCACAGGACAATAAATTCAGATTGTGCCACTCCCAGTCATGCACCCAATGCGGCCATGGAGATCATGACCGT
GAAAAGGGGTCTTTGGTCTTCTGCCAAGGTTGTACCGTGTCATACCATCAAGGTTGTCTTGGCGATCGAACCAGC
CGAAAGCACTTGGTCACCAAGGTTGACGAAGGGGATTTCATTCTTCAATGCAGTCGGTGTTTGGGGATCAAGCAC
CAAGAGCATGACATGAAGCCTCATTTAGGCCATTGTGCCGTGTGTAGAGACGAAGGACCCATGTCGCAGCCGTTG
CGAGAGACTCTTTCTTCCCAGACTGAGCAGCACTTGCGGGAAGCCAATGGTGGCATAGATCCGATTACTCCCGTG
GATATGTCCAGTGTCAACAATGTCGATAATATCCTCATCAGATGCCTTGGTGGCAGCCATAGCTGCAAGCGAGCC
TTCCATATTCAGCATCTACCAAACACGGCAGAGGAGAACCTTACCCACATTGATCCTGATAACTGGCAATGCGAC
GAATGCTCTAAATCACCTCCTGGTGCCAATCCAATCCAGGTGATCGTTGCTTGGAAACCAAGGAATCCCGAAGTC
AAAGTCGTCTCGCAGTTGGTTGAGATGATCCCAGAGATCGACAAACTATATCTCGTCAAGTGGCACAAGCTGTCC
TACTTCCGTGTTACCTGGGTGACTGGAGACTGGGTCTGGGCCAGGATTCCTGCCAGCCAGATGAAGGCGTTTCTC
AAGTCAGAAAGATCCACCAAACCGATTATGACAGTAGCTGAGGCTGTCCCCGAAGACAATCTGCGAGTGGACATT
GTTTTTGATGTGGAATATCACACCGAGCCTAAATCCCAGGAGGATCGAGCAAACGCCAAGATGGTCGAACGGGCA
TACGTCAAGTACAAAGGGTTGTCATACGAAGACTCAGTCTGGGAAATTCCCCCAGAACAGACTGACACAGCTCGT
TGGGAGGATTTCCAGACCGCTCTTATCGACAAAGTACGCCAAGAGAATGTCCACGTCCCGAAGCCGAAAGATCTT
CAAAGCCGTCTCAGAGATGTCCGTAGAGAGAAGTTTGACCAGAGCCTTCTTCTGACTGCTCAGCCTGCGTTGGTG
ACCGGTGGTGAGCTCATGGATTATCAGATGGAAGGCGTGAATTGGCTGCTGTACATGTTCTTCAAGCAAACCAAC
GCCATTCTTGCTGACGATATGGGCCTCGGAAAGACAATCCAGGTCATCACCCTATTCGCGGCATTGATCGATAAG
CTAGACTGTTTTCCATTCTTGGTCGTTGTTCCAAATGCGACTGTGCCAAACTGGCGCCGAGAGATCAAGAGCTGG
TCGCCACACATCCGGGTTGTCACCTATTATGGGAGTGCCTTCGCTCGCGAGATGGCCAGGGACCATGAGATGTTT
GACGAGAATGGCACTCTATGTTGCCATGTGGTTATTGCTTCGTATGAGAGCATGGCAGACGATGGGGCTAAGCGA
GTCTTGTCCAGTATCAATTGGGCTGGCTTGGTGGTTGATGAAGGTCAGCGCCTCAAGAATGACAAGACCCAGCTC
TATGAGCGTCTTCGTCGCATGAAATTCGGTTTCAAGTTGCTGCTCACTGGTACACCGCTTCAAAATAATATCAGA
GAGCTCTTCAACTTGGTTCAGTTCATCGACCCAACTTACAATGCGGAGGAGTTGGAGGCCAAATACGCAGGAGCC
CTCGACAGGGAAGCGATTCGCGAGCTCCACGACATGATTCGGCCATGTCTCCTGCGTCGAACAAAGGCAGAGGTT
CTGCCGTTCCTACCCCCGATGGTGCAAATCATCATTCCAGTTTCGATGTCTGTTGTGCAGAAGAAGCTGTACAAA
TCGATCCTTCAAAAGAACCCGCAGCTTCTCAAGGCTATTTGCAAGAAGCAAGTCGGGCAGTTGAAGAAAGCAGAG
CGCCATAATTTGAACAATATCCTAATGCAGCTGCGCAAATGTCTTTGTCACCCGTTCATTTATAACCGGGACATC
GAAGAGCAGACTCTGGACTCTCAGCTTTCCCATCGGCGTTTGGTCGAAGCATCCGGGAAGCTTACGTTGCTGAAC
TTGATGTTACCGCGACTTCGAGAGCGTGGACACCGCGTCCTCATCTTCAGTCAATTTTTAGAGAACCTCGACATT
GTTGAAGACTTCCTCACTGGACTGGGACTCCAGTACTGTCGCCTGGATGGAAACTTATCCTCGAGGGAAAAACAG
CAACAGATCGACCAGTTTAACGCGCCGAAATCCCAATTCTTTGCCTTTTTGCTTTCGACGCGGTCCGGTGGTGTC
GGAATTAACCTCGCCACTGCCGATACGGTCATCATCATGGATCCGGATTTCAATCCAAAACAAGACATGCAGGCT
CTGTCGCGTGCTCATCGAATCGGGCAAAAGAATACAGTCCTTGTTTTCCACCTGGTAGTGCGCGCGTCAGTGGAG
GAAAAAATCATGCAGAAAGGTAAAACCAAGATGGCACTCGATCACGTACTTATCGATCGCATCGAGGCCGATGAA
GATAAAGAAGACTTAGAGTCCATCCTCAAGCATGGTGCGGAGGCACTGTTCAATGACGATGACTCGGCAGACATT
ACTTACGATGTGGACTCCATTGACAAGCTGTTGGACCGTAGCCAGGCTGAGCAGGTCAAGAAAATTGCCAGCGAG
GGAAGTTCGGACCAGAATGAGCAGACGCAGTTCAATTTCGCCCGGGTGTGGCAAAAGGATCGAGGTAGCCTTGAA
GAAGTGACTGAGACTGAGGACACGCCTGTGGATGTTACGGCGTGGGAGAAGATTCTGCAGGAGCGTGAGCGTGAA
GCGCAGGAGGAAGCTAACCGTCAAGCTGAAGGTCTTGGGCGCGGTAAAAGAAAGCGCGGCACACCCCGCTACAAT
AACAATATTGTTATCGAAGGAGTTGACGACGATGAGAATCTTAGCCCCCGAAAGCCGCCTAGCAAGATGCGAAAG
CGTGCAGCTGACAATGACGATGAGTTCCAACAGCCAGAGGATGATGGTGATGAGACCGAGTTCGAGTCCGATCAC
GGCGCTGAGCCAATGGACCTTACATACGATGGAGCTGAGCCAATGGACACCGCAAATGACGGCGACAGGACTGAG
GCACAAATGGGCACTACAAATGTTGTCACACCTGGTCTTCATGTAGGTGCAGGACAGCAAGTCGCACGCGCGTTC
CGTTGTGTTAATTCCCCGCCCCCAGTGACCTACCACCTTGATATCCGTCCTTGTGTGGCGTGCAAACAACGCCAC
ATCCCTGGGCAGTGCCCACTCCGTTCGGCTGGTGTCGAGTTCTGTGGCCTCTGCGGCCTGGCGCACTGGGGTGGC
CGCCGGATCTGCCCCCACCTGCAGTCACGGGTGCAGGTCAGCCTTATGCTGGATACGCTGGAAGAGAGCCCGGAG
GACCCGGCCCTCATCCTTAAGGCGAAAAAATACCTTCGGGGTGTTCTCAAATCAATGGGGCAGACTGCCCGGAGC
AAGGCTTCGTCTGCCACTCAGGCGGAGTCTCGGATTTTCACCTCGCCCTCAGTTAGCGGGGTGAGCCGTGCCCCT
ACCGATTTAACAGGGGCAAGTACTGAGTCGAAAGACTAA
Transcript >Pro_DTO377G3_2|g7576.t1
ATGTCTCAATCTAGAGACAATTCTCCAGGCTCTGATAGCTCTGATGATGCTGATGCTGTGGCTGCACAATTGCTA
GCACAGTTCCAGAGCGCTCCCTCTTGTACTCCTCCCACCATCCCACCTGAGGGTCCTGAAAATGCCCTCCAGCCA
GTGCAACATATCACTAGAAACTCAAAAGAATCAACAATGTCTTTTGAGATCATCGTCCCAGTGGTTAACAACCCT
GATGACTATGAGTATTTGCCCGGTCACTTTGAGGTTCATCGCATTCTTGCAGTCGACATGCATGAGCCAAAGCTC
ATTGTGAGACTCAAAAGTGGTGAAGTTCAAACTATGACCACCAAAGATTTGAAAAGCCTCAAGAACGGACGAAAG
GCTTTGCGTGAATTCAACCGTGACTCACAGAGCCCTGACCCCCTCGCAATGGACCACTCCCCCATCCCACATTTC
ATTTACGCGGGTGGAGATGGTCCTGCGGACTATGATTCAGATATGGACTGGGGAATTGCACGAAACCGCCAACGA
CGCGCGCCGTTGGTCTCATACAACAATTTCTTCCGCAGTGATGATGAAGAAGATGAAGACGACTATCAAAGCCGC
CGTGAAGAGATTGACTCAGAGGAGTCCAGTGATGAGGATGAAGATGAAGATGATCCTCCAACCAAACGCCGCCAA
CGCCGCCCTCCGAGAAGGGGTGCGCAGAGGGGCCGAAAGCAACGTGATCGCGAATGGTCTGAACAGTCTTCTGCC
TCTGATACAGGCAAACGAGTATCATCTCGCCTGCGACAGACCCGTCGACGCAATATGAAAGAACGCTTCGAAGAC
GACGAATATTCTGCGGTTGAACCTGAGCAGCCTAAGCACCAAAAGTTCTCGGGTGCGAGGGAGCAGTTCCGTGAA
CTACCACAGGACAATAAATTCAGATTGTGCCACTCCCAGTCATGCACCCAATGCGGCCATGGAGATCATGACCGT
GAAAAGGGGTCTTTGGTCTTCTGCCAAGGTTGTACCGTGTCATACCATCAAGGTTGTCTTGGCGATCGAACCAGC
CGAAAGCACTTGGTCACCAAGGTTGACGAAGGGGATTTCATTCTTCAATGCAGTCGGTGTTTGGGGATCAAGCAC
CAAGAGCATGACATGAAGCCTCATTTAGGCCATTGTGCCGTGTGTAGAGACGAAGGACCCATGTCGCAGCCGTTG
CGAGAGACTCTTTCTTCCCAGACTGAGCAGCACTTGCGGGAAGCCAATGGTGGCATAGATCCGATTACTCCCGTG
GATATGTCCAGTGTCAACAATGTCGATAATATCCTCATCAGATGCCTTGGTGGCAGCCATAGCTGCAAGCGAGCC
TTCCATATTCAGCATCTACCAAACACGGCAGAGGAGAACCTTACCCACATTGATCCTGATAACTGGCAATGCGAC
GAATGCTCTAAATCACCTCCTGGTGCCAATCCAATCCAGGTGATCGTTGCTTGGAAACCAAGGAATCCCGAAGTC
AAAGTCGTCTCGCAGTTGGTTGAGATGATCCCAGAGATCGACAAACTATATCTCGTCAAGTGGCACAAGCTGTCC
TACTTCCGTGTTACCTGGGTGACTGGAGACTGGGTCTGGGCCAGGATTCCTGCCAGCCAGATGAAGGCGTTTCTC
AAGTCAGAAAGATCCACCAAACCGATTATGACAGTAGCTGAGGCTGTCCCCGAAGACAATCTGCGAGTGGACATT
GTTTTTGATGTGGAATATCACACCGAGCCTAAATCCCAGGAGGATCGAGCAAACGCCAAGATGGTCGAACGGGCA
TACGTCAAGTACAAAGGGTTGTCATACGAAGACTCAGTCTGGGAAATTCCCCCAGAACAGACTGACACAGCTCGT
TGGGAGGATTTCCAGACCGCTCTTATCGACAAAGTACGCCAAGAGAATGTCCACGTCCCGAAGCCGAAAGATCTT
CAAAGCCGTCTCAGAGATGTCCGTAGAGAGAAGTTTGACCAGAGCCTTCTTCTGACTGCTCAGCCTGCGTTGGTG
ACCGGTGGTGAGCTCATGGATTATCAGATGGAAGGCGTGAATTGGCTGCTGTACATGTTCTTCAAGCAAACCAAC
GCCATTCTTGCTGACGATATGGGCCTCGGAAAGACAATCCAGGTCATCACCCTATTCGCGGCATTGATCGATAAG
CTAGACTGTTTTCCATTCTTGGTCGTTGTTCCAAATGCGACTGTGCCAAACTGGCGCCGAGAGATCAAGAGCTGG
TCGCCACACATCCGGGTTGTCACCTATTATGGGAGTGCCTTCGCTCGCGAGATGGCCAGGGACCATGAGATGTTT
GACGAGAATGGCACTCTATGTTGCCATGTGGTTATTGCTTCGTATGAGAGCATGGCAGACGATGGGGCTAAGCGA
GTCTTGTCCAGTATCAATTGGGCTGGCTTGGTGGTTGATGAAGGTCAGCGCCTCAAGAATGACAAGACCCAGCTC
TATGAGCGTCTTCGTCGCATGAAATTCGGTTTCAAGTTGCTGCTCACTGGTACACCGCTTCAAAATAATATCAGA
GAGCTCTTCAACTTGGTTCAGTTCATCGACCCAACTTACAATGCGGAGGAGTTGGAGGCCAAATACGCAGGAGCC
CTCGACAGGGAAGCGATTCGCGAGCTCCACGACATGATTCGGCCATGTCTCCTGCGTCGAACAAAGGCAGAGGTT
CTGCCGTTCCTACCCCCGATGGTGCAAATCATCATTCCAGTTTCGATGTCTGTTGTGCAGAAGAAGCTGTACAAA
TCGATCCTTCAAAAGAACCCGCAGCTTCTCAAGGCTATTTGCAAGAAGCAAGTCGGGCAGTTGAAGAAAGCAGAG
CGCCATAATTTGAACAATATCCTAATGCAGCTGCGCAAATGTCTTTGTCACCCGTTCATTTATAACCGGGACATC
GAAGAGCAGACTCTGGACTCTCAGCTTTCCCATCGGCGTTTGGTCGAAGCATCCGGGAAGCTTACGTTGCTGAAC
TTGATGTTACCGCGACTTCGAGAGCGTGGACACCGCGTCCTCATCTTCAGTCAATTTTTAGAGAACCTCGACATT
GTTGAAGACTTCCTCACTGGACTGGGACTCCAGTACTGTCGCCTGGATGGAAACTTATCCTCGAGGGAAAAACAG
CAACAGATCGACCAGTTTAACGCGCCGAAATCCCAATTCTTTGCCTTTTTGCTTTCGACGCGGTCCGGTGGTGTC
GGAATTAACCTCGCCACTGCCGATACGGTCATCATCATGGATCCGGATTTCAATCCAAAACAAGACATGCAGGCT
CTGTCGCGTGCTCATCGAATCGGGCAAAAGAATACAGTCCTTGTTTTCCACCTGGTAGTGCGCGCGTCAGTGGAG
GAAAAAATCATGCAGAAAGGTAAAACCAAGATGGCACTCGATCACGTACTTATCGATCGCATCGAGGCCGATGAA
GATAAAGAAGACTTAGAGTCCATCCTCAAGCATGGTGCGGAGGCACTGTTCAATGACGATGACTCGGCAGACATT
ACTTACGATGTGGACTCCATTGACAAGCTGTTGGACCGTAGCCAGGCTGAGCAGGTCAAGAAAATTGCCAGCGAG
GGAAGTTCGGACCAGAATGAGCAGACGCAGTTCAATTTCGCCCGGGTGTGGCAAAAGGATCGAGGTAGCCTTGAA
GAAGTGACTGAGACTGAGGACACGCCTGTGGATGTTACGGCGTGGGAGAAGATTCTGCAGGAGCGTGAGCGTGAA
GCGCAGGAGGAAGCTAACCGTCAAGCTGAAGGTCTTGGGCGCGGTAAAAGAAAGCGCGGCACACCCCGCTACAAT
AACAATATTGTTATCGAAGGAGTTGACGACGATGAGAATCTTAGCCCCCGAAAGCCGCCTAGCAAGATGCGAAAG
CGTGCAGCTGACAATGACGATGAGTTCCAACAGCCAGAGGATGATGGTGATGAGACCGAGTTCGAGTCCGATCAC
GGCGCTGAGCCAATGGACCTTACATACGATGGAGCTGAGCCAATGGACACCGCAAATGACGGCGACAGGACTGAG
GCACAAATGGGCACTACAAATGTTGTCACACCTGGTCTTCATGTAGGTGCAGGACAGCAAGTCGCACGCGCGTTC
CGTTGTGTTAATTCCCCGCCCCCAGTGACCTACCACCTTGATATCCGTCCTTGTGTGGCGTGCAAACAACGCCAC
ATCCCTGGGCAGTGCCCACTCCGTTCGGCTGGTGTCGAGTTCTGTGGCCTCTGCGGCCTGGCGCACTGGGGTGGC
CGCCGGATCTGCCCCCACCTGCAGTCACGGGTGCAGGTCAGCCTTATGCTGGATACGCTGGAAGAGAGCCCGGAG
GACCCGGCCCTCATCCTTAAGGCGAAAAAATACCTTCGGGGTGTTCTCAAATCAATGGGGCAGACTGCCCGGAGC
AAGGCTTCGTCTGCCACTCAGGCGGAGTCTCGGATTTTCACCTCGCCCTCAGTTAGCGGGGTGAGCCGTGCCCCT
ACCGATTTAACAGGGGCAAGTACTGAGTCGAAAGACTAA
Gene >Pro_DTO377G3_2|g7576.t1
ATGTCTCAATCTAGAGACAATTCTCCAGGCTCTGATAGCTCTGATGATGCTGATGCTGTGGCTGCACAATTGCTA
GCACAGTTCCAGAGCGCTCCCTCTTGTACTCCTCCCACCATCCCACCTGAGGGTCCTGAAAATGCCCTCCAGCCA
GTGCAACATATCACTAGAAACTCAAAAGAATCAACAATGTCTTTTGAGATCATCGTCCCAGTGGTTAACAACCCT
GATGACTATGAGTATTTGCCCGGTCACTTTGAGGTTCATCGCATTCTTGCAGTCGACATGCATGAGCCAAAGCTC
ATTGTGAGACTCAAAAGTGGTGAAGTTCAAACTGTAAGCGAACACAAGTAATCAATCAATCTTAGGCGCCGTTCA
ACTGACCATGACTTTCACTAGATGACCACCAAAGATTTGAAAAGCCTCAAGAACGGACGAAAGGCTTTGCGTGAA
TTCAACCGTGACTCACAGAGCCCTGACCCCCTCGCAATGGACCACTCCCCCATCCCACATTTCATTTACGCGGGT
GGAGATGGTCCTGCGGACTATGATTCAGATATGGACTGGGGAATTGCACGAAACCGCCAACGACGCGCGCCGTTG
GTCTCATACAACAATTTCTTCCGCAGTGATGATGAAGAAGATGAAGACGACTATCAAAGCCGCCGTGAAGAGATT
GACTCAGAGGAGTCCAGTGATGAGGATGAAGATGAAGATGATCCTCCAACCAAACGCCGCCAACGCCGCCCTCCG
AGAAGGGGTGCGCAGAGGGGCCGAAAGCAACGTGATCGCGAATGGTCTGAACAGTCTTCTGCCTCTGATACAGGC
AAACGAGTATCATCTCGCCTGCGACAGACCCGTCGACGCAATATGAAAGAACGCTTCGAAGACGACGAATATTCT
GCGGTTGAACCTGAGCAGCCTAAGCACCAAAAGTTCTCGGGTGCGAGGGAGCAGTTCCGTGAACTACCACAGGAC
AATAAATTCAGATTGTGCCACTCCCAGTCATGCACCCAATGCGGCCATGGAGATCATGACCGTGAAAAGGGGTCT
TTGGTCTTCTGCCAAGGTTGTACCGTGTCATACCATCAAGGTTGTCTTGGCGATCGAACCAGCCGAAAGCACTTG
GTCACCAAGGTTGACGAAGGGGATTTCATTCTTCAATGCAGTCGGTGTTTGGGGATCAAGCACCAAGAGCATGAC
ATGAAGCCTCATTTAGGCCATTGTGCCGTGTGTAGAGACGAAGGACCCATGTCGCAGCCGTTGCGAGAGACTCTT
TCTTCCCAGACTGAGCAGCACTTGCGGGAAGCCAATGGTGGCATAGATCCGATTACTCCCGTGGATATGTCCAGT
GTCAACAATGTCGATAATATCCTCATCAGATGCCTTGGTGGCAGCCATAGCTGCAAGCGAGCCTTCCATATTCAG
CATCTACCAAACACGGCAGAGGAGAACCTTACCCACATTGATCCTGATAACTGGCAATGCGACGAATGCTCTAAA
TCACCTCCTGGTGCCAATCCAATCCAGGTGATCGTTGCTTGGAAACCAAGGAATCCCGAAGTCAAAGTCGTCTCG
CAGTTGGTTGAGATGATCCCAGAGATCGACAAACTATATCTCGTCAAGTGGCACAAGCTGTCCTACTTCCGTGTT
ACCTGGGTGACTGGAGACTGGGTCTGGGCCAGGATTCCTGCCAGCCAGATGAAGGCGTTTCTCAAGTCAGAAAGA
TCCACCAAACCGATTATGACAGTAGCTGAGGCTGTCCCCGAAGACAATCTGCGAGTGGACATTGTTTTTGATGTG
GAATATCACACCGAGCCTAAATCCCAGGAGGATCGAGCAAACGCCAAGATGGTCGAACGGGCATACGTCAAGTAC
AAAGGGTTGTCATACGAAGACTCAGTCTGGGAAATTCCCCCAGAACAGACTGACACAGCTCGTTGGGAGGATTTC
CAGACCGCTCTTATCGACAAAGTACGCCAAGAGAATGTCCACGTCCCGAAGCCGAAAGATCTTCAAAGCCGTCTC
AGAGATGTCCGTAGAGAGAAGTTTGACCAGAGCCTTCTTCTGACTGCTCAGCCTGCGTTGGTGACCGGTGGTGAG
CTCATGGATTATCAGATGGAAGGCGTGAATTGGCTGCTGTACATGTTCTTCAAGCAAACCAACGCCATTCTTGCT
GACGATATGGGCCTCGGAAAGACAATCCAGGTCATCACCCTATTCGCGGCATTGATCGATAAGCTAGACTGTTTT
CCATTCTTGGTCGTTGTTCCAAATGCGACTGTGCCAAACTGGCGCCGAGAGATCAAGAGCTGGTCGCCACACATC
CGGGTTGTCACCTATTATGGGAGTGCCTTCGCTCGCGAGATGGCCAGGGACCATGAGATGTTTGACGAGAATGGC
ACTCTATGTTGCCATGTGGTTATTGCTTCGTATGAGAGCATGGCAGACGATGGGGCTAAGCGAGTCTTGTCCAGT
ATCAATTGGGCTGGCTTGGTGGTTGATGAAGGTCAGCGCCTCAAGAATGACAAGACCCAGCTCTATGAGCGTCTT
CGTCGCATGAAATTCGGTTTCAAGTTGCTGCTCACTGGTACACCGCTTCAAAATAATATCAGAGAGCTCTTCAAC
TTGGTTCAGTTCATCGACCCAACTTACAATGCGGAGGAGTTGGAGGCCAAATACGCAGGAGCCCTCGACAGGGAA
GCGATTCGCGAGCTCCACGACATGATTCGGCCATGTCTCCTGCGTCGAACAAAGGCAGAGGTTCTGCCGTTCCTA
CCCCCGATGGTGCAAATCATCATTCCAGTTTCGATGTCTGTTGTGCAGAAGAAGCTGTACAAATCGATCCTTCAA
AAGAACCCGCAGCTTCTCAAGGCTATTTGCAAGAAGCAAGTCGGGCAGTTGAAGAAAGCAGAGCGCCATAATTTG
AACAATATCCTAATGCAGCTGCGCAAATGTCTTTGTCACCCGTTCATTTATAACCGGGACATCGAAGAGCAGACT
CTGGACTCTCAGCTTTCCCATCGGCGTTTGGTCGAAGCATCCGGGAAGCTTACGTTGCTGAACTTGATGTTACCG
CGACTTCGAGAGCGTGGACACCGCGTCCTCATCTTCAGTCAATTTTTAGAGAACCTCGACATTGTTGAAGACTTC
CTCACTGGACTGGGACTCCAGTACTGTCGCCTGGATGGAAACTTATCCTCGAGGGAAAAACAGCAACAGATCGAC
CAGTTTAACGCGCCGAAATCCCAATTCTTTGCCTTTTTGCTTTCGACGCGGTCCGGTGGTGTCGGAATTAACCTC
GCCACTGCCGATACGGTCATCATCATGGATCCGGATTTCAATCCAAAACAAGACATGCAGGCTCTGTCGCGTGCT
CATCGAATCGGGCAAAAGAATACAGTCCTTGTTTTCCACCTGGTAGTGCGCGCGTCAGTGGAGGAAAAAATCATG
CAGAAAGGTAAAACCAAGATGGCACTCGATCACGTACTTATCGATCGCATCGAGGCCGATGAAGATAAAGAAGAC
TTAGAGTCCATCCTCAAGCATGGTGCGGAGGCACTGTTCAATGACGATGACTCGGCAGACATTACTTACGATGTG
GACTCCATTGACAAGCTGTTGGACCGTAGCCAGGCTGAGCAGGTCAAGAAAATTGCCAGCGAGGGAAGTTCGGAC
CAGAATGAGCAGACGCAGTTCAATTTCGCCCGGGTGTGGCAAAAGGATCGAGGTAGCCTTGAAGAAGTGACTGAG
ACTGAGGACACGCCTGTGGATGTTACGGCGTGGGAGAAGATTCTGCAGGAGCGTGAGCGTGAAGCGCAGGAGGAA
GCTAACCGTCAAGCTGAAGGTCTTGGGCGCGGTAAAAGAAAGCGCGGCACACCCCGCTACAATAACAATATTGTT
ATCGAAGGAGTTGACGACGATGAGAATCTTAGCCCCCGAAAGCCGCCTAGCAAGATGCGAAAGCGTGCAGCTGAC
AATGACGATGAGTTCCAACAGCCAGAGGATGATGGTGATGAGACCGAGTTCGAGTCCGATCACGGCGCTGAGCCA
ATGGACCTTACATACGATGGAGCTGAGCCAATGGACACCGCAAATGACGGCGACAGGACTGAGGCACAAATGGGC
ACTACAAATGTTGTCACACCTGGTCTTCATGTAGGTGCAGGACAGCAAGGTGAGATCTAATCCATATTCCATGCG
TATCCTAGTTATTGCTTTTTTTTGTTTTTTTTTTTTTTTGATTTTAATACCCTATCATTCCGTATTGCCGTGTAA
AGACACAGTTCGTTAACTGTACATGATTCTCAGTCGCACGCGCGTTCCGTTGTGTTAATTCCCCGCCCCCAGTGA
CCTACCACCTTGATATCCGTCCTTGTGTGGCGTGCAAACAACGCCACATCCCTGGGCAGTGCCCACTCCGTTCGG
CTGGTGTCGAGTTCTGTGGCCTCTGCGGCCTGGCGCACTGGGGTGGCCGCCGGATCTGCCCCCACCTGCAGTCAC
GGGTGCAGGTCAGCCTTATGCTGGATACGCTGGAAGAGAGCCCGGAGGACCCGGCCCTCATCCTTAAGGCGAAAA
AATACCTTCGGGGTGTTCTCAAATCAATGGGGCAGACTGCCCGGAGCAAGGCTTCGTCTGCCACTCAGGCGGAGT
CTCGGATTTTCACCTCGCCCTCAGTTAGCGGGGTGAGCCGTGCCCCTACCGATTTAACAGGGGCAAGTACTGAGT
CGAAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail