Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7550.t1
Gene name
Locationscaffold_24:125776..127017
Strand+
Gene length (bp)1241
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10176 DUF2370 Protein of unknown function (DUF2370) 5.8E-92 145 346

GO

GO Term Description Terminal node
GO:0030001 metal ion transport Yes
GO:0007034 vacuolar transport Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051649 establishment of localization in cell No
GO:0051641 cellular localization No
GO:0046907 intracellular transport No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 210 232 22
2 302 324 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7550.t1
MSSQRYSRVNAQDEEEGPHSYPLNARPEHSNSSPSSFRSGSRSSSRSSRRLLHHDPQHDDDEQTLADAFGDEDGS
DDDNEPDDRQRLMRADSDFRAPPDNGPTTTASSSDSRGDPQDQIQSGLLRRPTLLPSFTTPASGGSRQIASSNDG
VFANLAAKPERGEKNDDLPPSYEEAAADATPPYWETTIVAPGISSDEVYVDGLPVGSVFSFIWNAMISMSFQLVG
FLLTYLLHTTHAAKNGSRAGLGLTLVQYGFYMKGGSSDSSGSEGGGSEYVPPPDPNSHNFDPNSVGEGGGNGGNG
AISGISTSEWISYILMIVGWFILIRAVSDFLRARRHEQLVLQSPDRGLGVPVIAEGERSETVV*
Coding >Pro_DTO377G3_2|g7550.t1
ATGAGCTCGCAGCGCTATTCACGGGTGAATGCCCAGGATGAAGAGGAAGGACCACATTCCTATCCGCTGAACGCG
CGACCTGAACATAGCAACTCTTCACCTTCGTCTTTCCGTTCCGGATCCCGCTCGTCGTCACGATCGTCAAGGCGG
CTATTACACCACGATCCGCAACACGACGATGACGAACAGACACTCGCCGATGCTTTTGGCGACGAAGACGGGTCC
GATGATGATAATGAGCCGGATGACCGACAGCGCTTGATGCGAGCAGACTCCGACTTCCGTGCTCCCCCGGATAAC
GGCCCTACCACCACGGCCTCTTCGTCGGACTCGAGAGGCGATCCGCAGGATCAGATTCAATCAGGGCTTCTCAGG
CGACCGACGCTATTACCAAGTTTTACGACCCCGGCTTCGGGAGGGAGTCGGCAGATCGCCTCATCGAATGATGGA
GTCTTTGCCAATCTTGCTGCCAAGCCTGAACGGGGTGAGAAGAATGATGATCTTCCTCCTTCATACGAAGAAGCC
GCAGCTGATGCGACACCGCCATATTGGGAGACCACCATTGTAGCTCCTGGTATCTCGTCAGACGAGGTCTATGTC
GATGGATTGCCTGTTGGATCTGTTTTCTCATTTATTTGGAACGCCATGATTTCAATGTCATTCCAGCTCGTTGGC
TTCTTGCTGACCTATCTTCTTCACACCACCCATGCCGCAAAGAACGGCAGCCGAGCGGGTCTCGGTCTTACTCTT
GTTCAATACGGCTTCTACATGAAAGGTGGCAGCAGCGACAGTTCCGGCTCCGAGGGTGGAGGCTCCGAATATGTC
CCTCCACCTGACCCCAACAGCCACAACTTCGACCCTAATTCGGTTGGTGAGGGTGGGGGTAATGGAGGGAACGGC
GCCATCTCTGGCATCAGCACCAGTGAATGGATTTCATATATTCTTATGATTGTTGGCTGGTTCATCTTAATCCGT
GCGGTCAGTGATTTCCTGCGGGCACGACGTCATGAACAGCTTGTTTTGCAGAGCCCGGATCGTGGCTTGGGTGTA
CCAGTCATTGCAGAGGGCGAACGATCCGAGACTGTTGTCTAA
Transcript >Pro_DTO377G3_2|g7550.t1
ATGAGCTCGCAGCGCTATTCACGGGTGAATGCCCAGGATGAAGAGGAAGGACCACATTCCTATCCGCTGAACGCG
CGACCTGAACATAGCAACTCTTCACCTTCGTCTTTCCGTTCCGGATCCCGCTCGTCGTCACGATCGTCAAGGCGG
CTATTACACCACGATCCGCAACACGACGATGACGAACAGACACTCGCCGATGCTTTTGGCGACGAAGACGGGTCC
GATGATGATAATGAGCCGGATGACCGACAGCGCTTGATGCGAGCAGACTCCGACTTCCGTGCTCCCCCGGATAAC
GGCCCTACCACCACGGCCTCTTCGTCGGACTCGAGAGGCGATCCGCAGGATCAGATTCAATCAGGGCTTCTCAGG
CGACCGACGCTATTACCAAGTTTTACGACCCCGGCTTCGGGAGGGAGTCGGCAGATCGCCTCATCGAATGATGGA
GTCTTTGCCAATCTTGCTGCCAAGCCTGAACGGGGTGAGAAGAATGATGATCTTCCTCCTTCATACGAAGAAGCC
GCAGCTGATGCGACACCGCCATATTGGGAGACCACCATTGTAGCTCCTGGTATCTCGTCAGACGAGGTCTATGTC
GATGGATTGCCTGTTGGATCTGTTTTCTCATTTATTTGGAACGCCATGATTTCAATGTCATTCCAGCTCGTTGGC
TTCTTGCTGACCTATCTTCTTCACACCACCCATGCCGCAAAGAACGGCAGCCGAGCGGGTCTCGGTCTTACTCTT
GTTCAATACGGCTTCTACATGAAAGGTGGCAGCAGCGACAGTTCCGGCTCCGAGGGTGGAGGCTCCGAATATGTC
CCTCCACCTGACCCCAACAGCCACAACTTCGACCCTAATTCGGTTGGTGAGGGTGGGGGTAATGGAGGGAACGGC
GCCATCTCTGGCATCAGCACCAGTGAATGGATTTCATATATTCTTATGATTGTTGGCTGGTTCATCTTAATCCGT
GCGGTCAGTGATTTCCTGCGGGCACGACGTCATGAACAGCTTGTTTTGCAGAGCCCGGATCGTGGCTTGGGTGTA
CCAGTCATTGCAGAGGGCGAACGATCCGAGACTGTTGTCTAA
Gene >Pro_DTO377G3_2|g7550.t1
ATGAGCTCGCAGCGCTATTCACGGGTACCCAATCCCCCTCCCCGCTGATCCCCTATCAGAACAAGCCCCTTGGAT
GGGATCCCTCGGCAACATACTGACCGCGACTGTCTAGGTGAATGCCCAGGATGAAGAGGAAGGACCACATTCCTA
TCCGCTGAACGCGCGACCTGAACATAGCAACTCTTCACCTTCGTCTTTCCGTTCCGGATCCCGCTCGTCGTCACG
ATCGTCAAGGCGGCTATTACACCACGATCCGCAACACGACGATGACGAACAGACACTCGCCGATGCTTTTGGCGA
CGAAGACGGGTCCGATGATGATAATGAGCCGGATGACCGACAGCGCTTGATGCGAGCAGACTCCGACTTCCGTGC
TCCCCCGGATAACGGCCCTACCACCACGGCCTCTTCGTCGGACTCGAGAGGCGATCCGCAGGATCAGATTCAATC
AGGGCTTCTCAGGCGACCGACGCTATTACCAAGTTTTACGACCCCGGCTTCGGGAGGGAGTCGGCAGATCGCCTC
ATCGAATGATGGAGTCTTTGCCAATCTTGCTGCCAAGCCTGAACGGGGTGAGAAGAATGATGATCTTCCTCCTGT
AAGTTGATCATTGATATTTTTGACCCAAAAAGAAAGACTTATTTACTGATATCTTATAGTCATACGAAGAAGCCG
CAGCTGATGCGACACCGCCATATTGGGAGACCACCATTGTAGCTCCTGGTATCTCGTCAGACGAGGTCTATGTCG
ATGGATTGCCTGTTGGATCTGTTTTCTCATTTATTTGGAACGCCATGATTTCAATGTCATTCCAGCTCGTTGGCT
TCTTGCTGACCTATCTTCTTCACACCACCCATGCCGCAAAGAACGGCAGCCGAGCGGGTCTCGGTCTTACTCTTG
TTCAATACGGCTTCTACATGAAAGGTGGCAGCAGCGACAGTTCCGGCTCCGAGGGTGGAGGCTCCGAATATGTCC
CTCCACCTGACCCCAACAGCCACAACTTCGACCCTAATTCGGTTGGTGAGGGTGGGGGTAATGGAGGGAACGGCG
CCATCTCTGGCATCAGCACCAGTGAATGGATTTCATATATTCTTATGATTGTTGGCTGGTTCATCTTAATCCGTG
CGGTCAGTGATTTCCTGCGGGCACGACGTCATGAACAGCTTGTTTTGCAGAGCCCGGATCGTGGCTTGGGTGTAC
CAGTCATTGCAGAGGGCGAACGATCCGAGACTGTTGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail