Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7539.t1
Gene name
Locationscaffold_24:94612..97506
Strand+
Gene length (bp)2894
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04109 ATG9 Autophagy protein ATG9 1.7E-211 206 695

GO

GO Term Description Terminal node
GO:0006914 autophagy Yes
GO:0008150 biological_process No
GO:0061919 process utilizing autophagic mechanism No
GO:0009056 catabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0044248 cellular catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 233 255 22
2 286 305 19
3 456 478 22
4 543 561 18
5 576 595 19
6 643 665 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 47.33 29.04 65.62
5d_25C Five days - 25 degrees Celsius 74.79 45.31 104.28
7d_25C Seven days - 25 degrees Celsius 81.20 48.94 113.46
10d_25C Ten days - 25 degrees Celsius 125.84 73.93 177.75
7d_15C Seven days - 15 degrees Celsius 87.64 52.24 123.03
7d_30C Seven days - 30 degrees Celsius 71.75 43.66 99.85

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.023188 yes
3d_25C 7d_25C 0.004450 yes
3d_25C 7d_15C 0.001804 yes
3d_25C 7d_30C 0.044390 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.782638 no
5d_25C 7d_15C 0.546715 no
5d_25C 7d_30C 0.898437 no
5d_25C 10d_25C 0.010411 yes
7d_25C 7d_15C 0.804485 no
7d_25C 7d_30C 0.655107 no
7d_25C 10d_25C 0.043201 yes
7d_15C 7d_30C 0.429801 no
7d_15C 10d_25C 0.105675 no
7d_30C 10d_25C 0.005235 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7539.t1
MMSSNILSRFLPPTGSRSVYETIRQHDVGSEYSDLEERAGLVIEDQQEQFSDRELEDALADAQDSEIISPSTALL
GQARSGKAPEERASPSGTRRRKSSRPRWMPQESPLGYELDDHDEDVPQSLLVEGHHEDLKSQLPPPPRLHGRPDR
RRTPSPGPSSQHTGTRWNEQAAHQTLPSESGHPIGRWFTGQHPGLANVDPKKKAMWRWANVEDLDNFLKDVYIYF
LGNGIWSILLTRVLNLLTFAFVVGFSTFLTNCIDYSKVRRSKTLDDILVPQCTANMSGSSTFLLWLFSFFWIGKL
FQYLLDIRRLKHLHDFYFYLLGVSDAEVQTISWQEVVSRLMALRDSNPSTAAAVSAKHRRFLGSQSKQRMDAHDI
ANRLMRKENYMIALVNKDILDLTLPIPFLKNRQLFSRTMEWNLNLCVMDYVFNEQGQLRTLFLKDTHRRALSDGL
RRRFIFAGVMNIFVAPFIVVYFMMHYFFRYFNEFKKNPGQIGSRQYTPMAEWKFREFNELWHLFERRINMSYPFA
SRYVDQFPKDKTIQVARFVAFISGALASVLALASVIDPELFLGFEITPDRTVLFYLGIFGTVWAFARGLAPEETD
VFDPEYALLELIDFTHYFPSGWKGRLHSDDVRKEFAILYQMKVVIFLEEILSMIFTPFVLWFSLPKCSDRLIDFF
REFTVHVDGVGYLCSFAVFDFKKGTNVLSQAGPGRRDPGKQDLRTDYFSTKDGKMLASYYGFLDNYGTTHQPNSR
RQFHPPPTLPTLNSPTAAEFGALPDRPDHLHARTGPTAGVPFGAQSMMGDSKLRQMGGFDHRSPAPSILLDPHHQ
PSTTGFRAARTSPQQHHRSRLGHPSTDTIDDEEEPLSQDGRESTIRQSGARTGNSSAGAGTSDGNLGGSWRMNPL
SKDEDDPDEGDEGENIDAIAGGGGVLGLIQQFQKVNTEGRRTGI*
Coding >Pro_DTO377G3_2|g7539.t1
ATGATGTCCTCTAACATATTATCACGGTTCCTACCTCCAACGGGCTCACGATCGGTCTATGAGACCATTCGCCAA
CATGACGTCGGGTCCGAATACTCTGATCTCGAAGAACGTGCGGGCTTGGTCATAGAAGACCAACAGGAACAATTT
AGTGACCGGGAACTGGAGGATGCACTAGCGGATGCACAGGATAGTGAAATAATCAGCCCCAGCACTGCATTGCTT
GGGCAGGCACGGTCGGGCAAAGCACCTGAAGAGCGAGCTTCTCCATCTGGCACCCGCCGTCGCAAGTCGTCCCGG
CCTCGGTGGATGCCACAAGAATCACCACTCGGATATGAGCTCGATGATCATGATGAGGACGTCCCTCAGTCTCTG
CTGGTGGAAGGTCATCACGAAGATCTGAAATCACAGTTACCTCCTCCTCCCCGACTTCATGGTCGTCCGGACCGA
CGAAGAACCCCTAGCCCTGGTCCATCCTCACAACACACCGGAACACGTTGGAATGAACAAGCAGCCCATCAAACA
CTGCCCAGTGAAAGCGGTCATCCAATAGGGAGATGGTTCACCGGCCAACACCCTGGTCTTGCCAATGTTGACCCC
AAGAAGAAGGCAATGTGGCGGTGGGCGAACGTCGAGGATCTGGATAACTTCTTAAAGGACGTCTACATATACTTC
TTAGGGAACGGAATTTGGTCTATTCTGCTGACTCGGGTGCTGAACCTCTTGACATTTGCATTCGTTGTTGGTTTC
TCTACATTCTTAACCAACTGCATTGATTATTCTAAGGTTCGGCGAAGTAAAACTCTGGATGACATCCTCGTGCCT
CAATGTACAGCAAATATGTCCGGGTCGTCCACATTTTTGCTGTGGCTTTTTAGCTTCTTCTGGATTGGGAAGCTT
TTCCAGTACCTACTAGACATTCGCAGGCTCAAACACCTGCATGACTTCTATTTCTACCTTCTCGGCGTCTCGGAT
GCCGAGGTGCAGACGATTTCATGGCAAGAAGTGGTCAGTCGACTGATGGCGTTGAGAGATTCGAATCCATCTACT
GCGGCTGCGGTTTCTGCCAAACATCGAAGATTCCTGGGCAGCCAGTCAAAGCAGAGAATGGACGCTCACGACATT
GCCAACCGCCTAATGCGCAAGGAGAACTACATGATCGCATTAGTGAACAAGGATATTCTGGACCTTACTCTCCCT
ATCCCGTTCCTCAAAAATCGACAACTCTTCTCCCGAACCATGGAATGGAATCTCAATCTTTGTGTCATGGACTAT
GTCTTTAATGAGCAAGGCCAACTGCGAACCCTGTTCCTCAAGGACACGCATCGGAGAGCCCTGAGTGATGGCTTA
CGTCGGCGCTTTATTTTCGCTGGCGTCATGAATATTTTCGTAGCGCCCTTTATTGTGGTCTATTTTATGATGCAC
TACTTCTTCCGGTACTTCAATGAGTTCAAGAAGAATCCGGGCCAAATCGGTTCCCGTCAATATACACCTATGGCG
GAGTGGAAATTCCGCGAGTTCAATGAGCTTTGGCATCTCTTTGAGCGTCGAATCAATATGTCTTATCCATTCGCT
AGTCGCTATGTGGACCAATTTCCCAAGGATAAGACTATTCAAGTGGCACGGTTCGTTGCTTTCATCTCTGGCGCT
CTTGCCTCGGTGTTGGCCCTTGCCTCGGTGATAGACCCGGAGCTCTTCCTTGGATTTGAAATTACTCCTGACCGG
ACTGTGCTATTCTATCTTGGTATTTTCGGTACAGTCTGGGCCTTTGCGCGAGGGCTGGCACCCGAAGAGACCGAT
GTCTTCGACCCCGAGTATGCACTTCTCGAGCTGATCGATTTTACTCATTACTTCCCGTCCGGATGGAAGGGGCGT
TTGCATAGCGACGACGTGCGGAAAGAATTTGCAATCCTCTATCAAATGAAAGTTGTGATATTCTTAGAGGAGATC
TTGAGCATGATTTTCACTCCTTTCGTCCTATGGTTCAGCTTGCCCAAGTGCAGTGACCGCCTCATTGACTTCTTC
CGGGAGTTCACCGTGCACGTCGACGGGGTAGGCTATCTCTGCTCTTTTGCCGTATTCGACTTCAAGAAGGGCACA
AATGTGCTTTCCCAAGCCGGGCCCGGGCGTCGAGACCCTGGCAAACAGGACCTGCGCACTGATTACTTCTCAACT
AAAGATGGCAAGATGCTAGCTTCCTACTATGGCTTCTTGGACAACTACGGTACCACTCATCAACCTAACAGCCGA
CGACAATTCCACCCACCGCCAACCTTGCCAACCCTCAACTCACCCACTGCAGCCGAGTTCGGTGCTCTTCCTGAT
CGCCCTGACCATCTCCATGCACGCACTGGGCCGACCGCCGGTGTGCCATTTGGCGCTCAATCAATGATGGGAGAC
TCTAAACTAAGGCAAATGGGAGGATTCGATCACCGATCTCCTGCTCCATCCATCCTGCTTGACCCGCACCACCAA
CCCTCAACCACTGGGTTCCGCGCCGCCCGAACCAGCCCCCAGCAGCACCATCGCTCCCGGCTCGGACACCCGTCT
ACGGATACTATCGACGACGAAGAAGAACCATTATCCCAAGACGGTCGTGAATCAACAATACGGCAGTCGGGTGCT
CGTACCGGTAATTCCAGTGCAGGTGCAGGCACTAGTGACGGTAACCTCGGCGGTTCTTGGCGCATGAACCCACTC
AGCAAGGACGAGGATGATCCTGATGAGGGCGATGAAGGTGAAAATATCGACGCCATTGCTGGTGGGGGCGGTGTT
TTGGGGTTGATTCAGCAGTTCCAGAAAGTTAATACCGAAGGCAGACGGACGGGGATTTAG
Transcript >Pro_DTO377G3_2|g7539.t1
ATGATGTCCTCTAACATATTATCACGGTTCCTACCTCCAACGGGCTCACGATCGGTCTATGAGACCATTCGCCAA
CATGACGTCGGGTCCGAATACTCTGATCTCGAAGAACGTGCGGGCTTGGTCATAGAAGACCAACAGGAACAATTT
AGTGACCGGGAACTGGAGGATGCACTAGCGGATGCACAGGATAGTGAAATAATCAGCCCCAGCACTGCATTGCTT
GGGCAGGCACGGTCGGGCAAAGCACCTGAAGAGCGAGCTTCTCCATCTGGCACCCGCCGTCGCAAGTCGTCCCGG
CCTCGGTGGATGCCACAAGAATCACCACTCGGATATGAGCTCGATGATCATGATGAGGACGTCCCTCAGTCTCTG
CTGGTGGAAGGTCATCACGAAGATCTGAAATCACAGTTACCTCCTCCTCCCCGACTTCATGGTCGTCCGGACCGA
CGAAGAACCCCTAGCCCTGGTCCATCCTCACAACACACCGGAACACGTTGGAATGAACAAGCAGCCCATCAAACA
CTGCCCAGTGAAAGCGGTCATCCAATAGGGAGATGGTTCACCGGCCAACACCCTGGTCTTGCCAATGTTGACCCC
AAGAAGAAGGCAATGTGGCGGTGGGCGAACGTCGAGGATCTGGATAACTTCTTAAAGGACGTCTACATATACTTC
TTAGGGAACGGAATTTGGTCTATTCTGCTGACTCGGGTGCTGAACCTCTTGACATTTGCATTCGTTGTTGGTTTC
TCTACATTCTTAACCAACTGCATTGATTATTCTAAGGTTCGGCGAAGTAAAACTCTGGATGACATCCTCGTGCCT
CAATGTACAGCAAATATGTCCGGGTCGTCCACATTTTTGCTGTGGCTTTTTAGCTTCTTCTGGATTGGGAAGCTT
TTCCAGTACCTACTAGACATTCGCAGGCTCAAACACCTGCATGACTTCTATTTCTACCTTCTCGGCGTCTCGGAT
GCCGAGGTGCAGACGATTTCATGGCAAGAAGTGGTCAGTCGACTGATGGCGTTGAGAGATTCGAATCCATCTACT
GCGGCTGCGGTTTCTGCCAAACATCGAAGATTCCTGGGCAGCCAGTCAAAGCAGAGAATGGACGCTCACGACATT
GCCAACCGCCTAATGCGCAAGGAGAACTACATGATCGCATTAGTGAACAAGGATATTCTGGACCTTACTCTCCCT
ATCCCGTTCCTCAAAAATCGACAACTCTTCTCCCGAACCATGGAATGGAATCTCAATCTTTGTGTCATGGACTAT
GTCTTTAATGAGCAAGGCCAACTGCGAACCCTGTTCCTCAAGGACACGCATCGGAGAGCCCTGAGTGATGGCTTA
CGTCGGCGCTTTATTTTCGCTGGCGTCATGAATATTTTCGTAGCGCCCTTTATTGTGGTCTATTTTATGATGCAC
TACTTCTTCCGGTACTTCAATGAGTTCAAGAAGAATCCGGGCCAAATCGGTTCCCGTCAATATACACCTATGGCG
GAGTGGAAATTCCGCGAGTTCAATGAGCTTTGGCATCTCTTTGAGCGTCGAATCAATATGTCTTATCCATTCGCT
AGTCGCTATGTGGACCAATTTCCCAAGGATAAGACTATTCAAGTGGCACGGTTCGTTGCTTTCATCTCTGGCGCT
CTTGCCTCGGTGTTGGCCCTTGCCTCGGTGATAGACCCGGAGCTCTTCCTTGGATTTGAAATTACTCCTGACCGG
ACTGTGCTATTCTATCTTGGTATTTTCGGTACAGTCTGGGCCTTTGCGCGAGGGCTGGCACCCGAAGAGACCGAT
GTCTTCGACCCCGAGTATGCACTTCTCGAGCTGATCGATTTTACTCATTACTTCCCGTCCGGATGGAAGGGGCGT
TTGCATAGCGACGACGTGCGGAAAGAATTTGCAATCCTCTATCAAATGAAAGTTGTGATATTCTTAGAGGAGATC
TTGAGCATGATTTTCACTCCTTTCGTCCTATGGTTCAGCTTGCCCAAGTGCAGTGACCGCCTCATTGACTTCTTC
CGGGAGTTCACCGTGCACGTCGACGGGGTAGGCTATCTCTGCTCTTTTGCCGTATTCGACTTCAAGAAGGGCACA
AATGTGCTTTCCCAAGCCGGGCCCGGGCGTCGAGACCCTGGCAAACAGGACCTGCGCACTGATTACTTCTCAACT
AAAGATGGCAAGATGCTAGCTTCCTACTATGGCTTCTTGGACAACTACGGTACCACTCATCAACCTAACAGCCGA
CGACAATTCCACCCACCGCCAACCTTGCCAACCCTCAACTCACCCACTGCAGCCGAGTTCGGTGCTCTTCCTGAT
CGCCCTGACCATCTCCATGCACGCACTGGGCCGACCGCCGGTGTGCCATTTGGCGCTCAATCAATGATGGGAGAC
TCTAAACTAAGGCAAATGGGAGGATTCGATCACCGATCTCCTGCTCCATCCATCCTGCTTGACCCGCACCACCAA
CCCTCAACCACTGGGTTCCGCGCCGCCCGAACCAGCCCCCAGCAGCACCATCGCTCCCGGCTCGGACACCCGTCT
ACGGATACTATCGACGACGAAGAAGAACCATTATCCCAAGACGGTCGTGAATCAACAATACGGCAGTCGGGTGCT
CGTACCGGTAATTCCAGTGCAGGTGCAGGCACTAGTGACGGTAACCTCGGCGGTTCTTGGCGCATGAACCCACTC
AGCAAGGACGAGGATGATCCTGATGAGGGCGATGAAGGTGAAAATATCGACGCCATTGCTGGTGGGGGCGGTGTT
TTGGGGTTGATTCAGCAGTTCCAGAAAGTTAATACCGAAGGCAGACGGACGGGGATTTAG
Gene >Pro_DTO377G3_2|g7539.t1
ATGATGTCCTCTAACATATTATCACGGTTCCTACCTCCAACGGGCTCACGATCGGTCTATGAGACCATTCGCCAA
CATGACGTCGGGTCCGAATACTCTGATCTCGAAGAACGTGCGGGCTTGGTCATAGAAGACCAACAGGAACAATTT
AGTGACCGGGAACTGGAGGATGCACTAGCGGATGCACAGGATAGTGAAATAATCAGCCCCAGCACTGCATTGCTT
GGGCAGGCACGGTCGGGCAAAGCACCTGAAGAGCGAGCTTCTCCATCTGGCACCCGCCGTCGCAAGTCGTCCCGG
CCTCGGTGGATGCCACAAGAATCACCACTCGGATATGAGCTCGATGATCATGATGAGGACGTCCCTCAGTCTCTG
CTGGTGGAAGGTCATCACGAAGATCTGAAATCACAGTTACCTCCTCCTCCCCGACTTCATGGTCGTCCGGACCGA
CGAAGAACCCCTAGCCCTGGTCCATCCTCACAACACACCGGAACACGTTGGAATGAACAAGCAGCCCATCAAACA
CTGCCCAGTGAAAGCGGTCATCCAATAGGGAGATGGTTCACCGGCCAACACCCTGGTCTTGCCAATGTTGACCCC
AAGAAGAAGGCAATGTGGCGGTGGGCGAACGTCGAGGATCTGGATAACTTCTTAAAGGACGTCTACATATACTTC
TTAGGGAACGGAATTTGGTCTATTCTGCTGACTCGGGTGCTGAACCTCTTGTAAGTTCACGATGAAACCCTTTCC
AAAGCATCCTAGGAGAAGCTGACAGTACACACAGGACATTTGCATTCGTTGTTGGTTTCTCTACATTCTTAACCA
ACTGCATTGATTATTCTAAGGTTCGGCGAAGTAAAACTCTGGATGACATCCTCGTGCCTCAATGTACAGCAAATA
TGTCCGGGTCGTCCACATTTTTGCTGTGGCTTTTTAGCTTCTTCTGGATTGGGAAGCTTTTCCAGTACCTACTAG
ACATTCGCAGGCTCAAACACCTGCATGACTTCTATTTCTACCTTCTCGGCGTCTCGGATGCCGAGGTGCAGACGA
TTTCATGGCAAGAAGTGGTCAGTCGACTGATGGCGTTGAGAGATTCGAATCCATCTACTGCGGCTGCGGTTTCTG
CCAAACATCGAAGATTCCTGGGCAGCCAGTCAAAGCAGAGAATGGACGCTCACGACATTGCCAACCGCCTAATGC
GCAAGGAGAACTACATGATCGCATTAGTGAACAAGGATATTCTGGACCTTACTCTCCCTATCCCGTTCCTCAAAA
ATCGACAACTCTTCTCCCGAACCATGGAATGGAATCTCAATCTTTGTGTCATGGACTATGTCTTTAATGAGCAAG
GCCAACTGCGAACCCTGTTCCTCAAGGACACGCATCGGAGAGCCCTGAGTGATGGCTTACGTCGGCGCTTTATTT
TCGCTGGCGTCATGAATATTTTCGTAGCGCCCTTTATTGTGGTCTATTTTATGATGCACTACTTCTTCCGGTACT
TCAATGAGTTCAAGAAGAATCCGGGCCAAATCGGTTCCCGTCAATATACACCTATGGCGGAGTGGAAATTCCGCG
AGTTCAATGAGCTTTGGCATCTCTTTGAGCGTCGAATCAATATGTCTTATCCATTCGCTAGTCGCTATGTGGACC
AATTTCCCAAGGATAAGACTATTCAAGTGGCACGGTTCGTTGCTTTCATCTCTGGCGCTCTTGCCTCGGTGTTGG
CCCTTGCCTCGGTGATAGACCCGGAGCTCTTCCTTGGATTTGAAATTACTCCTGACCGGACTGTGCTATTCTATC
TTGGTATTTTCGGTACAGTCTGGGCCTTTGCGCGAGGGCTGGCACCCGAAGAGACCGATGTCTTCGACCCCGAGT
ATGCACTTCTCGAGCTGATCGATTTTACTCATTACTTCCCGTCCGGATGGAAGGGGCGTTTGCATAGCGACGACG
TGCGGAAAGAATTTGCAATCCTCTATCAAATGAAAGTTGTGATATTCTTAGAGGAGATCTTGAGCATGATTTTCA
CTCCTTTCGTCCTATGGTTCAGCTTGCCCAAGTGCAGTGACCGCCTCATTGACTTCTTCCGGGAGTTCACCGTGC
ACGTCGACGGGGTAGGCTATCTCTGCTCTTTTGCCGTATTCGACTTCAAGAAGGGCACAAATGTGCTTTCCCAAG
CCGGGCCCGGGCGTCGAGACCCTGGCAAACAGGACCTGCGCACTGATTACTTCTCAACTAAAGATGGCAAGATGC
TAGCTTCCTACTATGGCTTCTTGGACAACTACGGTACCACTCATCAACCTAACAGCCGACGACAATTCCACCCAC
CGCCAACCTTGCCAACCCTCAACTCACCCACTGCAGCCGAGTTCGGTGCTCTTCCTGATCGCCCTGACCATCTCC
ATGCACGCACTGGGCCGACCGCCGGTGTGCCATTTGGCGCTCAATCAATGATGGGAGACTCTAAACTAAGGCAAA
TGGGAGGATTCGATCACCGATCTCCTGCTCCATCCATCCTGCTTGACCCGCACCACCAACCCTCAACCACTGGGT
TCCGCGCCGCCCGAACCAGCCCCCAGCAGCACCATCGCTCCCGGCTCGGACACCCGTCTACGGATACTATCGACG
ACGAAGAAGAACCATTATCCCAAGACGGTCGTGAATCAACAATACGGCAGTCGGGTGCTCGTACCGGTAATTCCA
GTGCAGGTGCAGGCACTAGTGACGGTAACCTCGGCGGTTCTTGGCGCATGAACCCACTCAGCAAGGACGAGGATG
ATCCTGATGAGGGCGATGAAGGTGAAAATATCGACGCCATTGCTGGTGGGGGCGGTGTTTTGGGGTTGATTCAGC
AGTTCCAGAAAGTTAATACCGAAGGCAGACGGACGGGGATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail