Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7521.t1
Gene name
Locationscaffold_24:34437..36787
Strand+
Gene length (bp)2350
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02020 W2 eIF4-gamma/eIF5/eIF2-epsilon 1.6E-19 611 690
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 1.8E-06 343 374
PF00483 NTP_transferase Nucleotidyl transferase 4.1E-06 34 155

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0009058 biosynthetic process Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0008150 biological_process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7521.t1
MAPKQKSGQKPKPNAAEEVEETFQAVVFADTFETRFEPFTRDKPRCLLPLANTPIIEYTLEFLANAGVEEVFLYG
GAHSDQLEKYINASKWRALSSPFKQLTFLKSTSTSVGDVMRDLDGKHLITGDFIVVSGDVISNLPIEGALAQHRA
RRALDKNAIMTMVLREAGLQHRTKSTSISPIFVIDPTKDRCLHYEEIDRHADEEHSSRLNIDAEIILKHPELDIR
QDLIDCSIDICTPDVLSLWSDSFDYQSPRKHYLYGVLKDYELNGKTLHTYIVKDHYAARVRNLKAYDAISKDVLS
RWTYPLCPDTNLLPGHTFTLRKGSMYQETGVTLARSCVIGRRTVIGQGTSIGDRAEVHNSVLGRNCKIGRNVKLD
GAYIWDDVVIGDNTDVRGAIIADGVVLGKNCAVAAGSLLSYGVKIADNIWVESGKRITKTRNDGSVGKNDPAVVG
EGGEGYEFIHGEEEEDEDDDVSVASSGLVYRMPNLSLSSASISTLSSEVSNTSWARSERSSFSADEDSDNFHHDA
SVSLFDSLREGVAADVVQLELVTLRMSANASDNQVRRAIVTSFMKHIQQLMEGGKGAGPAVNEVFTAYKEVIERT
LFDRSKGQKKDQVDLLLALQQDLIHRNKGDMVLLFTAKSLYELDLIEEEAYGQWWNDERSSNSEEMRTIRNQTQQ
FVDWLAEAEEESSEEESEEESDDE*
Coding >Pro_DTO377G3_2|g7521.t1
ATGGCCCCCAAACAGAAATCTGGGCAAAAGCCAAAGCCCAATGCGGCGGAGGAAGTGGAAGAGACCTTCCAAGCT
GTGGTGTTCGCAGATACCTTCGAGACGAGATTCGAGCCCTTCACCCGTGACAAGCCTCGTTGCCTTTTGCCACTC
GCAAATACCCCGATTATCGAATACACCCTCGAATTTCTGGCCAATGCGGGCGTGGAGGAGGTCTTCCTCTACGGA
GGAGCGCACTCGGATCAGCTGGAGAAATACATCAATGCATCGAAATGGAGGGCCCTGTCTTCTCCATTCAAGCAA
TTGACATTCCTCAAGTCGACTTCTACCTCTGTTGGTGACGTTATGCGCGACCTGGATGGAAAACACCTCATCACT
GGAGACTTCATTGTCGTGAGCGGCGATGTGATCAGCAACCTGCCCATCGAAGGCGCATTGGCTCAGCACCGGGCG
CGTCGAGCACTTGACAAGAATGCGATCATGACCATGGTTCTAAGGGAGGCTGGCCTACAGCACAGGACCAAGTCC
ACCTCAATTTCGCCAATTTTTGTCATTGACCCCACTAAGGACCGCTGTCTCCACTACGAGGAAATCGACCGCCAT
GCAGACGAGGAGCATTCCTCTCGCTTGAACATTGACGCCGAAATTATCCTCAAACACCCCGAATTGGACATCCGC
CAAGACTTGATCGACTGCAGCATCGATATCTGCACCCCGGACGTACTGAGCTTATGGTCGGATAGTTTCGATTAC
CAATCCCCCCGGAAACACTACCTGTATGGTGTTTTGAAGGACTATGAGCTGAACGGCAAGACTCTGCACACATAC
ATTGTCAAGGACCACTACGCTGCGCGCGTGCGCAACCTGAAGGCCTACGACGCGATTAGCAAGGATGTTCTCTCG
CGCTGGACATATCCCTTGTGCCCGGATACGAACCTACTCCCTGGTCACACGTTCACCCTTCGTAAAGGCAGCATG
TACCAAGAAACAGGGGTGACCCTGGCACGCTCTTGCGTCATTGGGCGCCGCACAGTTATCGGACAAGGCACTAGT
ATTGGGGACCGGGCAGAAGTCCACAACTCCGTACTCGGTCGAAACTGTAAAATTGGCCGCAATGTTAAGCTGGAT
GGTGCCTATATTTGGGACGATGTCGTGATCGGCGATAACACAGACGTCCGTGGGGCGATTATCGCTGATGGCGTG
GTTCTCGGTAAGAATTGTGCCGTTGCAGCGGGATCGCTTCTGTCCTATGGTGTCAAAATCGCAGATAACATCTGG
GTGGAGAGTGGGAAGCGTATCACGAAAACTCGAAACGACGGCAGTGTGGGCAAGAACGATCCCGCAGTCGTTGGC
GAAGGAGGCGAGGGCTATGAGTTTATTCACGGCGAGGAAGAGGAAGATGAGGACGACGACGTGAGCGTAGCCTCA
TCGGGACTTGTGTACCGCATGCCCAATCTCTCACTTTCTTCCGCCTCCATTTCAACACTATCATCCGAGGTCTCA
AATACCTCCTGGGCACGATCTGAGCGGAGCAGTTTCTCCGCCGACGAAGATTCCGACAATTTCCACCACGATGCA
TCAGTCAGCTTGTTCGACAGTCTACGCGAAGGCGTGGCAGCAGACGTGGTACAGCTTGAGCTGGTCACTCTGCGT
ATGAGCGCCAACGCCTCGGACAACCAGGTCCGTCGCGCTATCGTAACATCGTTTATGAAGCACATCCAGCAGCTC
ATGGAGGGCGGCAAGGGTGCCGGTCCGGCAGTCAATGAGGTTTTTACGGCATACAAGGAGGTTATTGAGCGCACT
CTATTCGATCGCAGCAAGGGACAAAAGAAGGACCAGGTTGATCTACTGCTCGCGCTCCAGCAGGATCTTATTCAT
CGTAATAAGGGTGATATGGTCCTTCTCTTTACTGCCAAGTCTCTATATGAACTTGACCTTATCGAGGAGGAGGCT
TACGGCCAGTGGTGGAATGATGAGCGGTCCAGTAACTCCGAAGAGATGCGGACTATCCGTAACCAGACCCAGCAA
TTTGTTGACTGGCTTGCCGAGGCAGAGGAGGAGAGTAGCGAGGAAGAATCCGAGGAAGAGAGTGATGATGAGTAG
Transcript >Pro_DTO377G3_2|g7521.t1
ATGGCCCCCAAACAGAAATCTGGGCAAAAGCCAAAGCCCAATGCGGCGGAGGAAGTGGAAGAGACCTTCCAAGCT
GTGGTGTTCGCAGATACCTTCGAGACGAGATTCGAGCCCTTCACCCGTGACAAGCCTCGTTGCCTTTTGCCACTC
GCAAATACCCCGATTATCGAATACACCCTCGAATTTCTGGCCAATGCGGGCGTGGAGGAGGTCTTCCTCTACGGA
GGAGCGCACTCGGATCAGCTGGAGAAATACATCAATGCATCGAAATGGAGGGCCCTGTCTTCTCCATTCAAGCAA
TTGACATTCCTCAAGTCGACTTCTACCTCTGTTGGTGACGTTATGCGCGACCTGGATGGAAAACACCTCATCACT
GGAGACTTCATTGTCGTGAGCGGCGATGTGATCAGCAACCTGCCCATCGAAGGCGCATTGGCTCAGCACCGGGCG
CGTCGAGCACTTGACAAGAATGCGATCATGACCATGGTTCTAAGGGAGGCTGGCCTACAGCACAGGACCAAGTCC
ACCTCAATTTCGCCAATTTTTGTCATTGACCCCACTAAGGACCGCTGTCTCCACTACGAGGAAATCGACCGCCAT
GCAGACGAGGAGCATTCCTCTCGCTTGAACATTGACGCCGAAATTATCCTCAAACACCCCGAATTGGACATCCGC
CAAGACTTGATCGACTGCAGCATCGATATCTGCACCCCGGACGTACTGAGCTTATGGTCGGATAGTTTCGATTAC
CAATCCCCCCGGAAACACTACCTGTATGGTGTTTTGAAGGACTATGAGCTGAACGGCAAGACTCTGCACACATAC
ATTGTCAAGGACCACTACGCTGCGCGCGTGCGCAACCTGAAGGCCTACGACGCGATTAGCAAGGATGTTCTCTCG
CGCTGGACATATCCCTTGTGCCCGGATACGAACCTACTCCCTGGTCACACGTTCACCCTTCGTAAAGGCAGCATG
TACCAAGAAACAGGGGTGACCCTGGCACGCTCTTGCGTCATTGGGCGCCGCACAGTTATCGGACAAGGCACTAGT
ATTGGGGACCGGGCAGAAGTCCACAACTCCGTACTCGGTCGAAACTGTAAAATTGGCCGCAATGTTAAGCTGGAT
GGTGCCTATATTTGGGACGATGTCGTGATCGGCGATAACACAGACGTCCGTGGGGCGATTATCGCTGATGGCGTG
GTTCTCGGTAAGAATTGTGCCGTTGCAGCGGGATCGCTTCTGTCCTATGGTGTCAAAATCGCAGATAACATCTGG
GTGGAGAGTGGGAAGCGTATCACGAAAACTCGAAACGACGGCAGTGTGGGCAAGAACGATCCCGCAGTCGTTGGC
GAAGGAGGCGAGGGCTATGAGTTTATTCACGGCGAGGAAGAGGAAGATGAGGACGACGACGTGAGCGTAGCCTCA
TCGGGACTTGTGTACCGCATGCCCAATCTCTCACTTTCTTCCGCCTCCATTTCAACACTATCATCCGAGGTCTCA
AATACCTCCTGGGCACGATCTGAGCGGAGCAGTTTCTCCGCCGACGAAGATTCCGACAATTTCCACCACGATGCA
TCAGTCAGCTTGTTCGACAGTCTACGCGAAGGCGTGGCAGCAGACGTGGTACAGCTTGAGCTGGTCACTCTGCGT
ATGAGCGCCAACGCCTCGGACAACCAGGTCCGTCGCGCTATCGTAACATCGTTTATGAAGCACATCCAGCAGCTC
ATGGAGGGCGGCAAGGGTGCCGGTCCGGCAGTCAATGAGGTTTTTACGGCATACAAGGAGGTTATTGAGCGCACT
CTATTCGATCGCAGCAAGGGACAAAAGAAGGACCAGGTTGATCTACTGCTCGCGCTCCAGCAGGATCTTATTCAT
CGTAATAAGGGTGATATGGTCCTTCTCTTTACTGCCAAGTCTCTATATGAACTTGACCTTATCGAGGAGGAGGCT
TACGGCCAGTGGTGGAATGATGAGCGGTCCAGTAACTCCGAAGAGATGCGGACTATCCGTAACCAGACCCAGCAA
TTTGTTGACTGGCTTGCCGAGGCAGAGGAGGAGAGTAGCGAGGAAGAATCCGAGGAAGAGAGTGATGATGAGTAG
Gene >Pro_DTO377G3_2|g7521.t1
ATGGCCCCCAAACAGAAATCTGGGCAAAAGCCAAAGCCCAATGCGGCGGAGGAAGTGGAAGAGACCTTCCAAGCT
GTGGTAGGTCTAGCAGTTGGCAAATGCTTGCGTGACTTCTCTATGTGTTATATATTTACTAACCTGTGCTTTGCT
TAGGTGTTCGCAGATACCTTCGAGACGAGATTCGAGCCCTTCACCCGTGACAAGCCTCGTGTATGTTCTACAGCA
AACCATCTATGCCCAAGACTTCGAATTAACGAACCAAATTATTAGTGCCTTTTGCCACTCGCAAATACCCCGATT
ATCGAATACACCCTCGAATTTCTGGCCAATGCGGGCGTGGAGGAGGTCTTCCTCTACGGAGGAGCGCACTCGGAT
CAGCTGGAGAAATACATCAAGTAGGCTTGCCCTAGGACTCTCCGGTACGGATGGCAGAGCTAACCTATATTGCTA
GTGCATCGAAATGGAGGGCCCTGTCTTCTCCATTCAAGCAATTGACATTCCTCAAGTCGACTTCTACCTCTGTTG
GTGACGTTATGCGCGACCTGGATGGAAAACACCTCATCACTGGAGACTTCATTGTCGTGAGCGGCGATGTGATCA
GCAACCTGCCCATCGAAGGCGCATTGGCTCAGCACCGGGCGCGTCGAGCACTTGACAAGAATGCGATCATGACCA
TGGTTCTAAGGGAGGCTGGCCTACAGCACAGGACCAAGTCCACCTCAATTTCGCCAATTTTTGTCATTGACCCCA
CTAAGGACCGCTGTCTCCACTACGAGGAAATCGACCGCCATGCAGACGAGGAGCATTCCTCTCGCTTGAACATTG
ACGCCGAAATTATCCTCAAACACCCCGAATTGGACATCCGCCAAGACTTGATCGACTGCAGCATCGATATCTGCA
CCCCGGACGTACTGAGCTTATGGTCGGATAGTTTCGATTACCAATCCCCCCGGAAACACTACCTGTATGGTGTTT
TGAAGGACTATGAGCTGAACGGCAAGACTCTGCACACATACATTGTCAAGGACCACTACGCTGCGCGCGTGCGCA
ACCTGAAGGCCTACGACGCGATTAGCAAGGATGTTCTCTCGCGCTGGACATATCCCTTGTGCCCGGATACGAACC
TACTCCCTGGTCACACGTTCACCCTTCGTAAAGGCAGCATGTACCAAGAAACAGGGGTGACCCTGGCACGCTCTT
GCGTCATTGGGCGCCGCACAGTTATCGGACAAGGCACTAGTATTGGGGACCGGGCAGAAGTCCACAACTCCGTAC
TCGGTCGAAACTGTAAAATTGGCCGCAATGTTAAGCTGGATGGTGCCTATATTTGGGACGATGTCGTGATCGGCG
ATAACACAGACGTCCGTGGGGCGATTATCGCTGATGGCGTGGTTCTCGGTAAGAATTGTGCCGTTGCAGCGGGAT
CGCTTCTGTCCTATGGTGTCAAAATCGCAGATAACATCTGGGTGGAGAGTGGGAAGCGTATCACGAAAACTCGAA
ACGACGGCAGTGTGGGCAAGAACGATCCCGCAGTCGTTGGCGAAGGAGGCGAGGGCTATGAGTTTATTCACGGCG
AGGAAGAGGAAGATGAGGACGACGACGTGAGCGTAGCCTCATCGGGACTTGGTATGTTTTTTTCTAGTGTGCTTC
TTCGGGTCCGCATTACTAATTTATGCTATCCACAGTGTACCGCATGCCCAATCTCTCACTTTCTTCCGCCTCCAT
TTCAACACTATCATCCGAGGTCTCAAATACCTCCTGGGCACGATCTGAGCGGAGCAGTTTCTCCGCCGACGAAGA
TTCCGACAATTTCCACCACGATGCATCAGTCAGCTTGTTCGACAGTCTACGCGAAGGCGTGGCAGCAGACGTGGT
ACAGCTTGAGCTGGTCACTCTGCGTATGAGCGCCAACGCCTCGGACAACCAGGTCCGTCGCGCTATCGTAACATC
GTTTATGAAGCACATCCAGCAGCTCATGGAGGGCGGCAAGGGTGCCGGTCCGGCAGTCAATGAGGTTTTTACGGC
ATACAAGGAGGTTATTGAGCGCACTCTATTCGATCGCAGCAAGGGACAAAAGAAGGACCAGGTTGATCTACTGCT
CGCGCTCCAGCAGGATCTTATTCATCGTAATAAGGGTGATATGGTCCTTCTCTTTACTGCCAAGTCTCTATATGA
ACTTGACCTTATCGAGGAGGAGGCTTACGGCCAGTGGTGGAATGATGAGCGGTCCAGTAACTCCGAAGAGATGCG
GACTATCCGTAACCAGACCCAGCAATTTGTTGACTGGCTTGCCGAGGCAGAGGAGGAGAGTAGCGAGGAAGAATC
CGAGGAAGAGAGTGATGATGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail