Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7517.t1
Gene name
Locationscaffold_24:22851..24444
Strand+
Gene length (bp)1593
Transcript length (bp)1221
Coding sequence length (bp)1221
Protein length (aa) 407

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00439 Bromodomain Bromodomain 9.8E-22 303 384
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 5.4E-08 122 193

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0008080 N-acetyltransferase activity Yes
GO:0016410 N-acyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0005488 binding No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7517.t1
MIAESPKSSKRKASEEAASPESGQQISKKARTDSPVKEEDGLLQKPPLRIVPFPEKPAVLEERRGDIEFRVVNND
GSHDSFIVLTGLKCIFQKQLPKMPKDYIARLVYDRSHLSMAIVKHPLEVVGGITYRPFNSRKFAEIVFCAISSDQ
QVKGYGAHLMSHLKDYVKATSPIMHFLTYADNYAIGYFKKQGFTKEITLDKAIWMGYIKDYEGGTLMQCTMLPRI
RYLEMGRMLTKQKESVQAKIRAFSRSHIIHPPPKEWKNGVYAIDPLSIPAIKESGWSPDMDEMARQPRHGPNYNQ
LLHLLNDMQNHSAAWPFTQPVNRDEVPDYYEVIMEPMDLSSMEEKHEKDLYPTPQDFIKDAMLIFDNCRRYNNET
TPYAKSANKLEKFMWQQIRNIPEWSHLADNH*
Coding >Pro_DTO377G3_2|g7517.t1
ATGATTGCTGAATCGCCAAAGAGTTCCAAGCGCAAAGCCTCTGAGGAGGCAGCTTCCCCGGAATCTGGGCAGCAG
ATTAGCAAGAAGGCGCGCACAGATTCCCCAGTGAAAGAGGAAGATGGCCTCCTTCAAAAGCCTCCGCTCCGAATT
GTTCCATTCCCTGAGAAGCCCGCCGTTCTTGAAGAACGCCGAGGCGACATTGAGTTCCGTGTCGTCAACAACGAT
GGTTCCCACGATAGCTTCATTGTCCTCACAGGCTTGAAGTGTATTTTCCAGAAACAACTTCCGAAGATGCCCAAG
GACTACATCGCACGCCTTGTCTACGATCGGTCCCATCTCTCGATGGCTATCGTAAAACATCCACTGGAAGTTGTT
GGAGGAATCACGTATCGTCCGTTCAATTCTCGAAAGTTTGCTGAGATTGTCTTCTGCGCTATATCTTCGGACCAA
CAAGTAAAGGGATACGGTGCACACTTGATGTCCCATCTCAAGGACTACGTGAAAGCTACATCTCCAATTATGCAC
TTCCTCACATACGCCGATAATTATGCCATTGGATACTTCAAGAAACAGGGCTTTACCAAGGAGATCACACTCGAT
AAAGCAATCTGGATGGGCTACATTAAAGATTACGAGGGTGGCACGCTCATGCAGTGTACTATGCTCCCGAGGATT
CGATATCTAGAGATGGGACGCATGCTCACCAAACAGAAAGAGTCTGTGCAAGCCAAGATTCGCGCCTTCAGTCGC
TCGCATATCATCCATCCCCCTCCGAAGGAATGGAAGAACGGAGTGTACGCGATCGATCCTCTTAGCATTCCCGCA
ATCAAAGAGTCCGGCTGGTCGCCAGACATGGATGAAATGGCTCGCCAACCACGCCATGGGCCCAACTATAACCAA
TTGCTCCACTTGTTGAACGATATGCAGAATCACAGCGCGGCTTGGCCGTTTACTCAACCCGTGAACCGCGATGAG
GTTCCAGACTACTACGAGGTAATCATGGAGCCCATGGATCTGTCGAGCATGGAAGAGAAGCATGAGAAGGACTTG
TACCCGACTCCACAGGACTTCATCAAGGACGCCATGTTGATCTTCGACAATTGCCGACGCTACAACAATGAGACT
ACACCATATGCCAAGAGCGCGAATAAGCTTGAGAAGTTCATGTGGCAGCAGATCCGGAATATTCCGGAGTGGTCG
CACCTTGCCGATAATCATTGA
Transcript >Pro_DTO377G3_2|g7517.t1
ATGATTGCTGAATCGCCAAAGAGTTCCAAGCGCAAAGCCTCTGAGGAGGCAGCTTCCCCGGAATCTGGGCAGCAG
ATTAGCAAGAAGGCGCGCACAGATTCCCCAGTGAAAGAGGAAGATGGCCTCCTTCAAAAGCCTCCGCTCCGAATT
GTTCCATTCCCTGAGAAGCCCGCCGTTCTTGAAGAACGCCGAGGCGACATTGAGTTCCGTGTCGTCAACAACGAT
GGTTCCCACGATAGCTTCATTGTCCTCACAGGCTTGAAGTGTATTTTCCAGAAACAACTTCCGAAGATGCCCAAG
GACTACATCGCACGCCTTGTCTACGATCGGTCCCATCTCTCGATGGCTATCGTAAAACATCCACTGGAAGTTGTT
GGAGGAATCACGTATCGTCCGTTCAATTCTCGAAAGTTTGCTGAGATTGTCTTCTGCGCTATATCTTCGGACCAA
CAAGTAAAGGGATACGGTGCACACTTGATGTCCCATCTCAAGGACTACGTGAAAGCTACATCTCCAATTATGCAC
TTCCTCACATACGCCGATAATTATGCCATTGGATACTTCAAGAAACAGGGCTTTACCAAGGAGATCACACTCGAT
AAAGCAATCTGGATGGGCTACATTAAAGATTACGAGGGTGGCACGCTCATGCAGTGTACTATGCTCCCGAGGATT
CGATATCTAGAGATGGGACGCATGCTCACCAAACAGAAAGAGTCTGTGCAAGCCAAGATTCGCGCCTTCAGTCGC
TCGCATATCATCCATCCCCCTCCGAAGGAATGGAAGAACGGAGTGTACGCGATCGATCCTCTTAGCATTCCCGCA
ATCAAAGAGTCCGGCTGGTCGCCAGACATGGATGAAATGGCTCGCCAACCACGCCATGGGCCCAACTATAACCAA
TTGCTCCACTTGTTGAACGATATGCAGAATCACAGCGCGGCTTGGCCGTTTACTCAACCCGTGAACCGCGATGAG
GTTCCAGACTACTACGAGGTAATCATGGAGCCCATGGATCTGTCGAGCATGGAAGAGAAGCATGAGAAGGACTTG
TACCCGACTCCACAGGACTTCATCAAGGACGCCATGTTGATCTTCGACAATTGCCGACGCTACAACAATGAGACT
ACACCATATGCCAAGAGCGCGAATAAGCTTGAGAAGTTCATGTGGCAGCAGATCCGGAATATTCCGGAGTGGTCG
CACCTTGCCGATAATCATTGA
Gene >Pro_DTO377G3_2|g7517.t1
ATGATTGCTGAATCGCCAAAGAGTAAGTGAACTTTCATACTTTCACATTGTATTTTGTCAAACTATTTCTGACAT
ACGACTATGGTATCAGGTTCCAAGCGCAAAGCCTCTGAGGAGGCAGCTTCCCCGGAATCTGGGCAGCAGATTAGC
AAGAAGGCGCGCACAGATTCCCCAGTGAAAGAGGTAAGAGGCTCCCCAGGGCTACTATGTAAATCGCTTCGCGTA
CCTGTTCTGACAAGTGCCCCGCACAGGAAGATGGCCTCCTTCAAAAGCCTCCGCTCCGAATTGTTCCATTCCCTG
AGAAGGTACCCTCCCATCCCACGCCACCATATCCTATGTCTCTTCGTGGACAATGGCTGATGATCACAGCCCGCC
GTTCTTGAAGAACGCCGAGGCGACATTGAGTTCCGTGTCGTCAACAACGATGGTTCCCACGATAGCTTCATTGTC
CTCACAGGCTTGAAGTGTATTTTCCAGAAACAACTTCCGAAGATGCCCAAGGACTACATCGCACGCCTTGTCTAC
GATCGGTCCCATCTCTCGATGGCTATCGTAAAACATCCACTGGAAGTTGTTGGGTATGTCACAAGTGCCTGCTGT
CCTTTATTGGTTGGATTAGGCCACTGACAAACTACAGAGGAATCACGTATCGTCCGTTCAATTCTCGAAAGTTTG
CTGAGATTGTCTTCTGCGCTATATCTTCGGACCAACAAGTAAAGGGATACGGTGCACACTTGATGTCCCATCTCA
AGGTAGACATGCTTATGGATCTGCAATTTCTATGCATATATCTGACTTATTGCCCTATAGGACTACGTGAAAGCT
ACATCTCCAATTATGCACTTCCTCACATACGCCGATAATTATGCCATTGGATACTTCAAGAAACAGGGCTTTACC
AAGGAGATCACACTCGATAAAGCAATCTGGATGGGCTACATTAAAGATTACGAGGGTGGCACGCTCATGCAGTGT
ACTATGCTCCCGAGGATTCGATATCTAGAGATGGGACGCATGCTCACCAAACAGAAAGAGTCTGTGCAAGCCAAG
ATTCGCGCCTTCAGTCGCTCGCATATCATCCATCCCCCTCCGAAGGAATGGAAGAACGGAGTGTACGCGATCGAT
CCTCTTAGCATTCCCGCAATCAAAGAGTCCGGCTGGTCGCCAGACATGGATGAAATGGCTCGCCAACCACGCCAT
GGGCCCAACTATAACCAATTGCTCCACTTGTTGAACGATATGCAGAATCACAGCGCGGCTTGGCCGTTTACTCAA
CCCGTGAACCGCGATGAGGTTCCAGACTACTACGAGGTAATCATGGAGCCCATGGATCTGTCGAGCATGGAAGAG
AAGCATGAGAAGGACTTGTACCCGACTCCACAGGACTTCATCAAGGACGCCATGTTGATCTTCGACAATTGCCGA
CGCTACAACAATGAGACTACACCATATGCCAAGAGCGCGAATAAGCTTGAGAAGTTCATGTGGCAGCAGATCCGG
AATATTCCGGAGTGGTCGGTTAGTATCCACAGTGAAGCTGTTCTCAAAGACAATTCTAACTCTGATATCTAGCAC
CTTGCCGATAATCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail