Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7489.t1
Gene name
Locationscaffold_23:313092..314161
Strand+
Gene length (bp)1069
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01302 CAP_GLY CAP-Gly domain 3.0E-26 179 257
PF14560 Ubiquitin_2 Ubiquitin-like domain 7.7E-14 27 99

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 20.91 8.83 32.99
5d_25C Five days - 25 degrees Celsius 14.71 5.45 23.96
7d_25C Seven days - 25 degrees Celsius 13.87 5.15 22.60
10d_25C Ten days - 25 degrees Celsius 10.44 3.41 17.47
7d_15C Seven days - 15 degrees Celsius 16.58 6.06 27.10
7d_30C Seven days - 30 degrees Celsius 20.77 8.93 32.60

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.356732 no
3d_25C 7d_25C 0.257976 no
3d_25C 7d_15C 0.571874 no
3d_25C 7d_30C 0.990368 no
3d_25C 10d_25C 0.039770 yes
5d_25C 7d_25C 0.915463 no
5d_25C 7d_15C 0.811380 no
5d_25C 7d_30C 0.361815 no
5d_25C 10d_25C 0.409113 no
7d_25C 7d_15C 0.699047 no
7d_25C 7d_30C 0.268682 no
7d_25C 10d_25C 0.507595 no
7d_15C 7d_30C 0.583725 no
7d_15C 10d_25C 0.221825 no
7d_30C 10d_25C 0.043971 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7489.t1
MAFQPTPMDISVIITNAALAKPGNSEPRFLTERRITPTWTVMQVKTKLETMTGIPPGCQRLRVKVPGRPDQWADG
DDRLIGDWGLVKGSEIEVNDNRPQTMRANFTDLSSVEKYVLPTETYEARSDSVLAWKKNQKLGRFDPNALSPEEA
LRHQVEKDRTEIQTRGITVARRAIVLPSSPPHIRRGTIRFIGPVPTIPITGPGRELQQDAKLPADLQPIWVGIEL
DEPMGKNDGSVGGQRYFECLGNRGVFVKPEKVEVGEFPPLGLDDDLDDLMEEI*
Coding >Pro_DTO377G3_2|g7489.t1
ATGGCATTCCAGCCTACCCCGATGGATATCTCCGTCATCATCACCAACGCGGCTTTAGCCAAACCTGGAAATTCG
GAGCCTCGATTCCTGACTGAACGCCGCATCACCCCAACTTGGACGGTGATGCAGGTTAAGACAAAGTTAGAGACT
ATGACGGGAATCCCACCAGGATGCCAGCGCCTGCGGGTGAAAGTTCCCGGTCGACCTGACCAATGGGCCGATGGG
GACGACCGCCTGATTGGGGATTGGGGGTTGGTCAAGGGGTCGGAGATCGAGGTCAATGACAACCGCCCGCAAACC
ATGCGGGCTAACTTTACCGACTTATCATCAGTCGAGAAATATGTGCTGCCAACTGAGACATACGAGGCCCGTTCG
GACTCTGTGTTGGCTTGGAAGAAGAACCAGAAGCTGGGTCGGTTTGACCCTAACGCTCTATCGCCCGAAGAGGCT
TTGCGACATCAAGTTGAGAAAGACCGGACCGAGATTCAAACGAGAGGAATCACTGTTGCTAGACGAGCTATCGTT
CTGCCTTCATCTCCGCCGCATATTCGACGTGGCACGATCCGCTTCATTGGACCTGTTCCGACTATTCCTATTACC
GGCCCGGGTCGCGAGCTGCAACAGGATGCAAAGCTTCCGGCAGATCTCCAGCCGATCTGGGTCGGGATTGAGCTT
GACGAGCCGATGGGGAAGAATGACGGTAGTGTGGGCGGACAGCGCTACTTCGAGTGCTTAGGCAACAGGGGCGTC
TTCGTGAAGCCCGAGAAGGTCGAGGTTGGAGAATTCCCCCCGCTGGGTCTAGATGACGACCTAGATGACCTAATG
GAGGAAATTTAA
Transcript >Pro_DTO377G3_2|g7489.t1
ATGGCATTCCAGCCTACCCCGATGGATATCTCCGTCATCATCACCAACGCGGCTTTAGCCAAACCTGGAAATTCG
GAGCCTCGATTCCTGACTGAACGCCGCATCACCCCAACTTGGACGGTGATGCAGGTTAAGACAAAGTTAGAGACT
ATGACGGGAATCCCACCAGGATGCCAGCGCCTGCGGGTGAAAGTTCCCGGTCGACCTGACCAATGGGCCGATGGG
GACGACCGCCTGATTGGGGATTGGGGGTTGGTCAAGGGGTCGGAGATCGAGGTCAATGACAACCGCCCGCAAACC
ATGCGGGCTAACTTTACCGACTTATCATCAGTCGAGAAATATGTGCTGCCAACTGAGACATACGAGGCCCGTTCG
GACTCTGTGTTGGCTTGGAAGAAGAACCAGAAGCTGGGTCGGTTTGACCCTAACGCTCTATCGCCCGAAGAGGCT
TTGCGACATCAAGTTGAGAAAGACCGGACCGAGATTCAAACGAGAGGAATCACTGTTGCTAGACGAGCTATCGTT
CTGCCTTCATCTCCGCCGCATATTCGACGTGGCACGATCCGCTTCATTGGACCTGTTCCGACTATTCCTATTACC
GGCCCGGGTCGCGAGCTGCAACAGGATGCAAAGCTTCCGGCAGATCTCCAGCCGATCTGGGTCGGGATTGAGCTT
GACGAGCCGATGGGGAAGAATGACGGTAGTGTGGGCGGACAGCGCTACTTCGAGTGCTTAGGCAACAGGGGCGTC
TTCGTGAAGCCCGAGAAGGTCGAGGTTGGAGAATTCCCCCCGCTGGGTCTAGATGACGACCTAGATGACCTAATG
GAGGAAATTTAA
Gene >Pro_DTO377G3_2|g7489.t1
ATGGCATTCCAGCCTACCCCGATGGATATCTCCGTCATCATCACCAACGCGGCTTTAGCCAAACCTGGAAATTCG
GAGCCTCGATTCCTGACTGAACGCCGCATCACCCCAACTTGGACGGTGATGCAGGTTAAGACAAAGTTAGAGACT
ATGACGGGAATCCCACCAGGATGCCAGCGCCTGCGGGTGAAAGTTCCCGGTCGACCTGACCAATGGGCCGATGGG
GACGACCGCCTGATTGGGGATTGGGGGTTGGTCAAGGGGTCGGAGATCGAGGTGGGTTCTCTTTTCTTTCTATGT
CTTGCTGTTCATTTGACCCTGTTCTGGCTGCTTTACCGGGCCCAAAACGGCATGTCGTTTGATCCGAGTTGTCAG
GGCAATGGATATGCTACGAATTCTGGGCATATTCTAATTTATCCCCTCACTAGGTCAATGACAACCGCCCGCAAA
CCATGCGGGCTAACTTTACCGACTTATCATCAGTCGAGAAATATGTGCTGCCAACTGAGACATACGAGGCCCGTT
CGGACTCTGTGTTGGCTTGGAAGAAGAACCAGAAGCTGGGTCGGTTTGACCCTAACGCTCTATCGCCCGAAGAGG
CTTTGCGACATCAAGTTGAGAAAGACCGGACCGAGATTCAAACGAGAGGTTCGTTGAAACAAAAAATTTCAAGTG
TCAATGCAATTTATTTTTATTTTTCTTTCATTAATCTAATAATATATTGGCAGGAATCACTGTTGCTAGACGAGC
TATCGTTCTGCCTTCATCTCCGCCGCATATTCGACGTGGCACGATCCGCTTCATTGGACCTGTTCCGACTATTCC
TATTACCGGCCCGGGTCGCGAGCTGCAACAGGATGCAAAGCTTCCGGCAGATCTCCAGCCGATCTGGGTCGGGAT
TGAGCTTGACGAGCCGATGGGGAAGAATGACGGTAGTGTGGGCGGACAGCGCTACTTCGAGTGCTTAGGCAACAG
GGGCGTCTTCGTGAAGCCCGAGAAGGTCGAGGTTGGAGAATTCCCCCCGCTGGGTCTAGATGACGACCTAGATGA
CCTAATGGAGGAAATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail