Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7487.t1
Gene name
Locationscaffold_23:309874..310810
Strand+
Gene length (bp)936
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 9.7E-11 91 134

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 16.44 6.47 26.41
5d_25C Five days - 25 degrees Celsius 16.45 6.48 26.41
7d_25C Seven days - 25 degrees Celsius 17.30 6.77 27.82
10d_25C Ten days - 25 degrees Celsius 10.89 3.71 18.07
7d_15C Seven days - 15 degrees Celsius 21.43 9.29 33.56
7d_30C Seven days - 30 degrees Celsius 17.44 7.07 27.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.998162 no
3d_25C 7d_25C 0.924656 no
3d_25C 7d_15C 0.486092 no
3d_25C 7d_30C 0.905443 no
3d_25C 10d_25C 0.262461 no
5d_25C 7d_25C 0.927479 no
5d_25C 7d_15C 0.491663 no
5d_25C 7d_30C 0.908289 no
5d_25C 10d_25C 0.269326 no
7d_25C 7d_15C 0.587244 no
7d_25C 7d_30C 0.988193 no
7d_25C 10d_25C 0.202249 no
7d_15C 7d_30C 0.591950 no
7d_15C 10d_25C 0.031751 yes
7d_30C 10d_25C 0.172223 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7487.t1
MIALQNRPILPPVKVDISLLLKPQDEEEAAPGLNTGYPPRTIGPPLGLGPMMTMPGPAAMVMPPLTKSGPSGAAK
RLQPSHTSESPAKKQSKWSPDEDALIIELRGSGMKWEDISKRLPGRSAISCRLHYQNYLERRSEWDEDKKNKLAR
LYERFKAEMWSKVAEEMAIPWRAAEAMHWQLGEQEMARRAGVVPFSLSSAAIDPPTTRTRRASTSLSRPRKGSSS
RAIPGHLPGLPPQLPSLEELTAGVPAYAPAPPPPREFYGIGRPPEMGIPPPNFMGHHLGMPPRTMP*
Coding >Pro_DTO377G3_2|g7487.t1
ATGATTGCGTTACAAAATCGGCCTATATTGCCTCCTGTCAAAGTGGATATCTCACTGCTACTCAAGCCCCAGGAT
GAGGAAGAAGCCGCCCCCGGCCTGAACACTGGGTACCCGCCCAGAACGATAGGGCCACCACTCGGTCTGGGTCCC
ATGATGACTATGCCAGGCCCGGCTGCCATGGTGATGCCACCCTTGACCAAGTCCGGTCCATCGGGTGCTGCCAAG
CGCCTGCAGCCCTCGCATACGTCCGAATCTCCAGCCAAGAAGCAGTCCAAATGGTCGCCAGATGAGGACGCCCTG
ATCATCGAACTGCGTGGCAGTGGCATGAAGTGGGAGGATATCAGCAAACGACTCCCCGGCCGCAGTGCCATCAGT
TGCCGTCTCCATTATCAGAACTACTTGGAACGCCGCAGTGAATGGGATGAAGATAAGAAGAACAAACTAGCCCGT
TTATACGAGAGGTTCAAAGCCGAAATGTGGTCCAAGGTAGCGGAGGAAATGGCTATCCCATGGCGTGCAGCAGAG
GCCATGCACTGGCAGCTGGGAGAGCAGGAGATGGCTCGACGCGCAGGCGTGGTGCCATTCTCTCTCTCCAGTGCT
GCCATCGATCCCCCAACCACTAGAACCCGCCGTGCCAGCACCTCTCTATCCCGGCCGAGAAAGGGATCTTCCTCA
CGCGCAATCCCAGGCCATCTGCCAGGACTTCCACCTCAACTTCCCTCCCTGGAAGAGCTCACTGCAGGCGTCCCT
GCATACGCACCGGCTCCACCGCCCCCGAGAGAGTTCTATGGAATTGGACGACCACCAGAGATGGGGATTCCCCCA
CCAAATTTCATGGGCCATCACCTTGGCATGCCCCCCCGGACCATGCCTTAG
Transcript >Pro_DTO377G3_2|g7487.t1
ATGATTGCGTTACAAAATCGGCCTATATTGCCTCCTGTCAAAGTGGATATCTCACTGCTACTCAAGCCCCAGGAT
GAGGAAGAAGCCGCCCCCGGCCTGAACACTGGGTACCCGCCCAGAACGATAGGGCCACCACTCGGTCTGGGTCCC
ATGATGACTATGCCAGGCCCGGCTGCCATGGTGATGCCACCCTTGACCAAGTCCGGTCCATCGGGTGCTGCCAAG
CGCCTGCAGCCCTCGCATACGTCCGAATCTCCAGCCAAGAAGCAGTCCAAATGGTCGCCAGATGAGGACGCCCTG
ATCATCGAACTGCGTGGCAGTGGCATGAAGTGGGAGGATATCAGCAAACGACTCCCCGGCCGCAGTGCCATCAGT
TGCCGTCTCCATTATCAGAACTACTTGGAACGCCGCAGTGAATGGGATGAAGATAAGAAGAACAAACTAGCCCGT
TTATACGAGAGGTTCAAAGCCGAAATGTGGTCCAAGGTAGCGGAGGAAATGGCTATCCCATGGCGTGCAGCAGAG
GCCATGCACTGGCAGCTGGGAGAGCAGGAGATGGCTCGACGCGCAGGCGTGGTGCCATTCTCTCTCTCCAGTGCT
GCCATCGATCCCCCAACCACTAGAACCCGCCGTGCCAGCACCTCTCTATCCCGGCCGAGAAAGGGATCTTCCTCA
CGCGCAATCCCAGGCCATCTGCCAGGACTTCCACCTCAACTTCCCTCCCTGGAAGAGCTCACTGCAGGCGTCCCT
GCATACGCACCGGCTCCACCGCCCCCGAGAGAGTTCTATGGAATTGGACGACCACCAGAGATGGGGATTCCCCCA
CCAAATTTCATGGGCCATCACCTTGGCATGCCCCCCCGGACCATGCCTTAG
Gene >Pro_DTO377G3_2|g7487.t1
ATGATTGCGTTACAAAATCGGCCTATATTGCCTCCTGTCAAAGTGGATATCTCACTGCTACTCAAGCCCCAGGAT
GAGGAAGAAGCCGCCCCCGGCCTGAACACTGGGTACCCGCCCAGAACGATAGGGCCACCACTCGGTCTGGGTCCC
ATGATGACTATGCCAGGCCCGGCTGCCATGGTGATGCCACCCTTGACCAAGTCCGGTCCATCGGGTGCTGCCAAG
CGCCTGCAGCCCTCGCATACGTCCGAATCTCCAGCCAAGAAGCAGTCCAAATGGTCGCCAGATGAGGACGCCCTG
ATCATCGAACTGCGTGGCAGTGGCATGAAGTGGGAGGATATCAGCAAACGACTCCCCGGCCGCAGTGCCATCAGT
TGCCGTCTCCATTATCAGAACTACTTGGAACGCCGCAGTGAATGGGATGAAGATAAGAAGAACAAACTAGCCCGT
TTATACGAGAGGTAGGTTTGGGATAGGGATGACAAGAAACCAAATTCACTAATCTCACACTCGTCTGGCAGGTTC
AAAGCCGAAATGTGGTCCAAGGTAGCGGAGGAAATGGCTATCCCATGGCGTGCAGCAGAGGCCATGCACTGGCAG
CTGGGAGAGCAGGAGATGGCTCGACGCGCAGGCGTGGTGCCATTCTCTCTCTCCAGTGCTGCCATCGATCCCCCA
ACCACTAGAACCCGCCGTGCCAGCACCTCTCTATCCCGGCCGAGAAAGGGATCTTCCTCACGCGCAATCCCAGGC
CATCTGCCAGGACTTCCACCTCAACTTCCCTCCCTGGAAGAGCTCACTGCAGGCGTCCCTGCATACGCACCGGCT
CCACCGCCCCCGAGAGAGTTCTATGGAATTGGACGACCACCAGAGATGGGGATTCCCCCACCAAATTTCATGGGC
CATCACCTTGGCATGCCCCCCCGGACCATGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail